BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001976-TA|BGIBMGA001976-PA|IPR002931|Transglutaminase- like, IPR008958|Transglutaminase-like, C-terminal, IPR013807|Transglutaminase, C-terminal (626 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 25 1.4 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/37 (32%), Positives = 21/37 (56%) Query: 60 AREIYDFDQDIYILFNPWNPDDQTYMEDCTLLQEYVL 96 AR+ Y+ D ++YIL +P+N Y L E+++ Sbjct: 225 ARQFYNDDANVYILPDPYNTKFFRYRITPELYSEHLV 261 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.134 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,482 Number of Sequences: 429 Number of extensions: 7793 Number of successful extensions: 10 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 1 length of query: 626 length of database: 140,377 effective HSP length: 62 effective length of query: 564 effective length of database: 113,779 effective search space: 64171356 effective search space used: 64171356 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -