GeneModel BLAST Result against bee

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001976-TA|BGIBMGA001976-PA|IPR002931|Transglutaminase-
like, IPR008958|Transglutaminase-like, C-terminal,
IPR013807|Transglutaminase, C-terminal
         (626 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    25   1.4  

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 25.4 bits (53), Expect = 1.4
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 60  AREIYDFDQDIYILFNPWNPDDQTYMEDCTLLQEYVL 96
           AR+ Y+ D ++YIL +P+N     Y     L  E+++
Sbjct: 225 ARQFYNDDANVYILPDPYNTKFFRYRITPELYSEHLV 261


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.317    0.134    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,482
Number of Sequences: 429
Number of extensions: 7793
Number of successful extensions: 10
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 9
Number of HSP's gapped (non-prelim): 1
length of query: 626
length of database: 140,377
effective HSP length: 62
effective length of query: 564
effective length of database: 113,779
effective search space: 64171356
effective search space used: 64171356
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.6 bits)
S2: 46 (22.6 bits)