BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001975-TA|BGIBMGA001975-PA|undefined (163 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 34 0.050 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 32 0.20 SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_44228| Best HMM Match : LMP (HMM E-Value=0.11) 31 0.46 SB_21610| Best HMM Match : HSF_DNA-bind (HMM E-Value=0.32) 31 0.46 SB_2092| Best HMM Match : RVT_1 (HMM E-Value=0.00047) 31 0.46 SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.1 SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) 29 1.4 SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_42365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_22695| Best HMM Match : TSP_3 (HMM E-Value=5.9) 29 1.9 SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_4827| Best HMM Match : RCSD (HMM E-Value=1.7) 29 2.5 SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 29 2.5 SB_53076| Best HMM Match : IER (HMM E-Value=0.00068) 28 3.3 SB_52728| Best HMM Match : Herpes_UL3 (HMM E-Value=1.7) 28 3.3 SB_6487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_3697| Best HMM Match : Mucin (HMM E-Value=4.2) 28 3.3 SB_7782| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_48933| Best HMM Match : Drf_FH1 (HMM E-Value=1.4) 28 4.3 SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07) 28 4.3 SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) 28 4.3 SB_72| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_41521| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_20266| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_9398| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.7 SB_33129| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_57444| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 27 7.6 SB_39577| Best HMM Match : DUF1213 (HMM E-Value=0.54) 27 7.6 SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_21508| Best HMM Match : THAP (HMM E-Value=0.0086) 27 7.6 SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0) 27 7.6 SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_48907| Best HMM Match : Transket_pyr (HMM E-Value=0) 27 10.0 SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_31746| Best HMM Match : HR1 (HMM E-Value=2.1) 27 10.0 SB_15701| Best HMM Match : MT-A70 (HMM E-Value=1.6e-17) 27 10.0 SB_52998| Best HMM Match : DUF827 (HMM E-Value=4.4) 27 10.0 SB_47731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_38811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_36352| Best HMM Match : NAP (HMM E-Value=0.5) 27 10.0 SB_32316| Best HMM Match : Baculo_p24 (HMM E-Value=1.2) 27 10.0 SB_31241| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_24634| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00054) 27 10.0 SB_23226| Best HMM Match : Herpes_UL43 (HMM E-Value=1.9) 27 10.0 SB_16430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_11585| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2) 27 10.0 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 34.3 bits (75), Expect = 0.050 Identities = 24/100 (24%), Positives = 52/100 (52%), Gaps = 7/100 (7%) Query: 20 KHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPE--SKLDDWRVPFKTSASVQY 77 K +K +D + +G LG+ +T +++S+NT P+ S+L R P + +++ Sbjct: 643 KAIDKSIDSTVTEQTSNGGDLGNQETKQNQVSRNTRKRPKRGSQLTPTRTPKRAKQNLE- 701 Query: 78 EETKRDSCSVPKRKKNIQPLPIKS----KAKSLQNQNIIE 113 +++ R+ S + K+++ P K + S++N I+E Sbjct: 702 KQSARELDSQSEDKEDVPEEPCKGASDIRGNSVENNGIVE 741 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 32.3 bits (70), Expect = 0.20 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 8/65 (12%) Query: 98 PIKSKAKSLQNQNIIEAAFPISVPP--------KIIRKRSPRTRKVETPRKTPTLRSHKG 149 P + +AK + + +IE PIS K I ++ + KV+ ++ PT R K Sbjct: 5102 PTEREAKPFEEKPLIEEELPISAEKVVEEKPLEKPIARKEKKVEKVKPKKEKPTEREAKP 5161 Query: 150 LENKH 154 LE KH Sbjct: 5162 LEEKH 5166 Score = 29.5 bits (63), Expect = 1.4 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Query: 88 PKRKKNIQ--PLPIKSKAKSLQNQNIIEAAFPISVPP--KIIRKRSPRTRKVETPRKTPT 143 PK++K + P+K K + + + + P K I ++ + KV+ ++ PT Sbjct: 6219 PKKEKPTEREAKPLKEKPLVEEKELTVSVEKAVEEKPLEKPIARKEKKVEKVKPKKEKPT 6278 Query: 144 LRSHKGLENKH 154 R K LE KH Sbjct: 6279 EREAKPLEEKH 6289 >SB_53578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 31.5 bits (68), Expect = 0.35 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 3/78 (3%) Query: 81 KRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRK 140 KR C +K +Q + K+K L+ Q+ I+ +S PP ++ KR T +VET Sbjct: 1184 KRTKCKSSSPRK-LQKITTPEKSK-LETQSPIKVDVSLS-PPALVIKRQNNTWQVETKEH 1240 Query: 141 TPTLRSHKGLENKHSKLK 158 + + K L+ K K Sbjct: 1241 ETSTTTTKRLQKSLKKAK 1258 >SB_44228| Best HMM Match : LMP (HMM E-Value=0.11) Length = 276 Score = 31.1 bits (67), Expect = 0.46 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Query: 4 QRARHTDALQRIMISFKHFEKKL-DKLQDDVNDHGKTLGDLKTMVSKLSQNTV 55 QR RH+D +QRI +H KL K++ ++ + + DL+ + K ++ +V Sbjct: 198 QRQRHSDEIQRISAEHEHQCAKLSQKIESLSSEQEEAIQDLEKQLKKANKESV 250 >SB_21610| Best HMM Match : HSF_DNA-bind (HMM E-Value=0.32) Length = 425 Score = 31.1 bits (67), Expect = 0.46 Identities = 29/135 (21%), Positives = 59/135 (43%), Gaps = 15/135 (11%) Query: 18 SFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLS-QNTVIGPESKLDDWRVPFKTSASVQ 76 + H + K+ +L+++ + + L ++ + L +N + E L + F V+ Sbjct: 282 AISHRQDKIQRLEENGSTLDRRLAEIMEELENLKKENETLNTEKILTQQQNEFM-GGLVE 340 Query: 77 YEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVE 136 + K D P R++ QPL + + N+ EA ++ SPRTR + Sbjct: 341 VDGPKED----PSRQQRQQPLKRPQETTRDPDPNLFEAQ---------AQQYSPRTRPSQ 387 Query: 137 TPRKTPTLRSHKGLE 151 TP + + S+ G++ Sbjct: 388 TPSRKTSQHSYGGIK 402 >SB_2092| Best HMM Match : RVT_1 (HMM E-Value=0.00047) Length = 712 Score = 31.1 bits (67), Expect = 0.46 Identities = 15/44 (34%), Positives = 24/44 (54%) Query: 79 ETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPP 122 + R+ C P+ K + + I+SK KSLQ + I + A P + P Sbjct: 391 QVSREKCVQPREKGGLAAIHIQSKVKSLQLKWIAQVANPDNKAP 434 >SB_23651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1174 Score = 29.9 bits (64), Expect = 1.1 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 12/88 (13%) Query: 71 TSASVQYEETKRDSCSVPKRKKNIQPLPIKS-------KAKSLQNQNIIEA-----AFPI 118 T S EE K + P RK + +P K K++S +++ E A P Sbjct: 532 TEESSSEEEQKPPPRTTPVRKTAVNSIPAKPSQQRAQLKSESTGSESETETSSEEEAAPT 591 Query: 119 SVPPKIIRKRSPRTRKVETPRKTPTLRS 146 PP + R+P TR TP + ++ S Sbjct: 592 KTPPSTVNSRTPVTRAQSTPSLSSSVTS 619 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 29.9 bits (64), Expect = 1.1 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Query: 69 FKTSASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKR 128 F V +E DS S PK++K ++ + K ++ + +++ P P K R+ Sbjct: 194 FAVCKEVHLDEAGGDS-SKPKKRKGVKEAGHGNDHKEDKSNDNLKSRSPSPAPKKAPRRG 252 Query: 129 SPRTRKVETPRKTPTLR-SHKGLENK 153 S R R V ++ T SH E K Sbjct: 253 SKRKRGVNNQQEKRTDELSHNNKEKK 278 >SB_59437| Best HMM Match : AAA (HMM E-Value=7.4e-08) Length = 568 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Query: 117 PISVPPKIIRKRSPRT-RKVETPRKTPTLRSHKGLENKHSKLKEQI 161 P + PPK K +P +K TP+KT +++ K E+K ++ E+I Sbjct: 19 PETPPPKTPTKSTPSPIKKQVTPKKTTPVKALKEPESKKARTPEKI 64 >SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 972 Score = 29.1 bits (62), Expect = 1.9 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 93 NIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTP 142 ++Q P SK +SLQ ++ E PI P+ + RSP R +P P Sbjct: 87 HVQQSPAFSKMRSLQLTSVSE---PIQANPRKMLVRSPAVRSTSSPPLPP 133 >SB_42365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 791 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/68 (20%), Positives = 31/68 (45%) Query: 26 LDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKRDSC 85 L+K ++ ++ K +G+ K +K + D+W P++ + S + +R S Sbjct: 137 LEKKDEEKSEEVKEIGEDKGKPAKSGYTGITSTRFGSDEWHDPWQRTTSPKRRSPRRSSS 196 Query: 86 SVPKRKKN 93 S R ++ Sbjct: 197 SYSSRSRS 204 >SB_22695| Best HMM Match : TSP_3 (HMM E-Value=5.9) Length = 259 Score = 29.1 bits (62), Expect = 1.9 Identities = 25/128 (19%), Positives = 52/128 (40%), Gaps = 7/128 (5%) Query: 12 LQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGP----ESKLDDWRV 67 +++++ S K L + +D ND T+ D + +S +GP S + + Sbjct: 1 MRKVLSSLKR-SSTLPSINEDKNDD--TIQDFCETFNLVSSEDNLGPLEVRSSNITTLQS 57 Query: 68 PFKTSASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRK 127 ++ ++ R + P ++N +PL + +K + + P S K R Sbjct: 58 SGFSTRPYEHRSKARKATRAPNMRRNSEPLTVLAKDLGKLKHTVRRKSIPPSTNQKKERT 117 Query: 128 RSPRTRKV 135 +SP + V Sbjct: 118 QSPTYKHV 125 >SB_56158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 4/77 (5%) Query: 81 KRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRK 140 +R S+P RK+ PLP K+L + + + S PP+ +R++ P ++ P + Sbjct: 124 RRRHQSLP-RKQQRNPLPKNLLPKNLLPRKLQNPSLQRSQPPRNLRRKPPPRSPLKRPPR 182 Query: 141 TPTLRSHKGLENKHSKL 157 + L + L NK +L Sbjct: 183 SKVLPT---LYNKTKRL 196 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.1 bits (62), Expect = 1.9 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 3/82 (3%) Query: 13 QRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVI-GPESKLDDWRVPFKT 71 +++ S H++K++ K +DDV ++ K + K NT+I + LDD R ++ Sbjct: 1530 EKLKESMLHYQKRILKFKDDVQNYSKEYTSPRG--KKGDPNTLIEDKQFGLDDDRRRKRS 1587 Query: 72 SASVQYEETKRDSCSVPKRKKN 93 S S + + + S S +R+++ Sbjct: 1588 SKSSKKRDRRSRSRSRERRRRS 1609 >SB_4827| Best HMM Match : RCSD (HMM E-Value=1.7) Length = 269 Score = 28.7 bits (61), Expect = 2.5 Identities = 30/103 (29%), Positives = 42/103 (40%), Gaps = 3/103 (2%) Query: 42 DLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKRDSCSVPKRKKNIQPLPIKS 101 +L+ +V L +N P DD V S+ + + D+ S PK K + LP + Sbjct: 2 NLEEVVQFLQENMHAYPYD--DDEVVELLQSSMFELKRLGLDTPSPPK-KDELPQLPPGA 58 Query: 102 KAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTL 144 K Q A KII R R E+PR+ PTL Sbjct: 59 ALKRGTYQTASARARKNKEKNKIIALPVERPRSPESPRRIPTL 101 >SB_56913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1603 Score = 28.7 bits (61), Expect = 2.5 Identities = 18/68 (26%), Positives = 27/68 (39%) Query: 71 TSASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSP 130 T+ ++E+ P R K + K KAK N + + S P K R++ P Sbjct: 78 TAPGSDFKESSTPEPVKPPRPKRLNSFKRKDKAKKTDNVGKQDISIDSSDPVKPPRRKLP 137 Query: 131 RTRKVETP 138 VE P Sbjct: 138 NPPPVEKP 145 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Query: 24 KKLDKLQDDVNDHG----KTLGDLKTMVSKLSQNTVI 56 + L+KLQ V HG K GD++ M+ ++ Q T+I Sbjct: 580 RALEKLQASVERHGDKYIKARGDVQRMIEEVKQETII 616 >SB_53076| Best HMM Match : IER (HMM E-Value=0.00068) Length = 243 Score = 28.3 bits (60), Expect = 3.3 Identities = 33/136 (24%), Positives = 62/136 (45%), Gaps = 18/136 (13%) Query: 26 LDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKRDSC 85 L K+ D G TL +VS + N + +S D +R P T + Y+ + +S Sbjct: 13 LSKITDCRRRRGTTLRR-SLLVSNVLNNVLTSSDSAYDHYRTPKDT--DMDYDAVETESF 69 Query: 86 SVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPI--SVPPKIIRKR----SPRTRKVETPR 139 S+ + P+P++ S + N++E P + K++ +R +P+ R +P+ Sbjct: 70 SLDR------PVPLRD--DSFVSGNVLETRNPSHKASETKVLCERPLMENPQVRST-SPK 120 Query: 140 KTPTLRSHKGLENKHS 155 + RS LE+ +S Sbjct: 121 DIESERSTLNLESNNS 136 >SB_52728| Best HMM Match : Herpes_UL3 (HMM E-Value=1.7) Length = 398 Score = 28.3 bits (60), Expect = 3.3 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 4/80 (5%) Query: 68 PFKTSASVQYEETKRDSCSVPKR--KKNIQPLPIKSKAKSLQ--NQNIIEAAFPISVPPK 123 P + A+ E T C++ ++ K ++ + I+ K++ ++ NQ + P + PP Sbjct: 176 PVEKRANTAVENTADSRCTLTRQRPKSSLDRMQIERKSELVEFMNQRTKRQSRPSTAPPC 235 Query: 124 IIRKRSPRTRKVETPRKTPT 143 R PR+ +P PT Sbjct: 236 SPRTSIPRSSIPRSPIHVPT 255 >SB_6487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 967 Score = 28.3 bits (60), Expect = 3.3 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Query: 28 KLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKRD 83 K Q+DV + L D KT V N+V + LD W T VQ ++ K D Sbjct: 356 KQQNDVTELQSALNDTKTDVQI---NSVKHEKDVLDLWTATNNTKTDVQAQKVKHD 408 >SB_3697| Best HMM Match : Mucin (HMM E-Value=4.2) Length = 120 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Query: 123 KIIRKRSPRTRKVETPRKTPTLRSH 147 K ++KR P TR + PR T T +SH Sbjct: 18 KKVQKRGPYTRDDKCPRNTRTAKSH 42 >SB_7782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 28.3 bits (60), Expect = 3.3 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 7/82 (8%) Query: 74 SVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSL--QNQNIIEAAFPISVPPKIIR---KR 128 +V E D+ S+ +KKN+ P+K+ A L +N + S+ K +R K+ Sbjct: 123 TVDSNEESSDTSSLENKKKNLNKYPVKNNADRLLVPPRNDLNDTEEDSLSKKQLREAAKQ 182 Query: 129 SPRTRKV--ETPRKTPTLRSHK 148 R K+ ET R+ L K Sbjct: 183 KKREEKILLETERRLKKLEKEK 204 >SB_3285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/50 (30%), Positives = 22/50 (44%) Query: 3 LQRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQ 52 + R D L R+ I+F H +LQD+ N H + D+ L Q Sbjct: 1061 ITRKELLDQLSRMRINFFHMAATSTRLQDEDNRHTVAIADMGNYQEVLRQ 1110 >SB_1817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 28.3 bits (60), Expect = 3.3 Identities = 32/147 (21%), Positives = 59/147 (40%), Gaps = 8/147 (5%) Query: 20 KHFEKKLDKLQDDVND--HGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQY 77 KH EK+ + + + + + V++ VIG + + + V F + + Sbjct: 322 KHIEKRRESGNSETEEIETSEGISSENDGVAERVTTGVIGDSASVKEEAV-FPRNGEEKP 380 Query: 78 EETKRDSC---SVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRK 134 EET+ + +V K + P K + S+ NI + P++ PP + R Sbjct: 381 EETEEEGSIYGNVSTTSKPLAPPEEKEEECSIYG-NISTTSTPVAPPPTPPTRGGSTKRP 439 Query: 135 VETPR-KTPTLRSHKGLENKHSKLKEQ 160 + TPR K P +K + + K Q Sbjct: 440 LPTPRPKPPVTLRNKSVPGPNQKQPAQ 466 >SB_48933| Best HMM Match : Drf_FH1 (HMM E-Value=1.4) Length = 611 Score = 27.9 bits (59), Expect = 4.3 Identities = 17/68 (25%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Query: 78 EETKRDSCSVPKRKKNIQPLP-IKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVE 136 ++ K PK ++ P+P I + A+ + I + P+ P+I + P T + E Sbjct: 28 DQPKAIQPETPKDTPSMLPVPEIATPAQQPETPKDIPSMVPV---PEIATSQQPETIQPE 84 Query: 137 TPRKTPTL 144 TP+ P++ Sbjct: 85 TPKDIPSM 92 Score = 26.6 bits (56), Expect = 10.0 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 7/106 (6%) Query: 45 TMVSKLSQNTVIGPES-KLDDWRVPFKTSASVQYEETKRDSCSVPKRKKNIQPL-PIKSK 102 T S LS + + P+ K P T + + E + P+ K+I + P+ Sbjct: 14 TTTSMLSVSEIATPDQPKAIQPETPKDTPSMLPVPEIATPA-QQPETPKDIPSMVPVPEI 72 Query: 103 AKSLQNQNIIEAA---FPISVP-PKIIRKRSPRTRKVETPRKTPTL 144 A S Q + I P VP P+I + P T + ETP+ P++ Sbjct: 73 ATSQQPETIQPETPKDIPSMVPVPEIATPQQPETIQPETPKDIPSM 118 >SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07) Length = 807 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 18 SFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKL 50 S+K F K LDKL+ + H KT G + + S++ Sbjct: 276 SWKSFFKDLDKLKCNCKRHSKTCGCMSSNFSRM 308 >SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) Length = 1382 Score = 27.9 bits (59), Expect = 4.3 Identities = 28/128 (21%), Positives = 57/128 (44%), Gaps = 11/128 (8%) Query: 35 DHGKTLGDLKTMVSKLSQNTVIGPESKL-DDWRVPFKTSASVQYEETKRDSCSVPKRKKN 93 DHG + + +SKL+ I K+ DWR T +Y + + D V KK+ Sbjct: 649 DHGTSRNE---EMSKLAAELAIQSFKKVFSDWRDIALTMRDREYAQDEEDQIDVFDVKKS 705 Query: 94 IQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPTLRSHKGLENK 153 ++P+ K+L+++++++ + S P +S + ET + S + + Sbjct: 706 LRPV-----LKALRSRSLLQISEGTSEEP--TEAKSMADKDKETSASSTGTDSETDIRTR 758 Query: 154 HSKLKEQI 161 +L+ +I Sbjct: 759 RKQLRCKI 766 >SB_72| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 313 Score = 27.9 bits (59), Expect = 4.3 Identities = 12/49 (24%), Positives = 27/49 (55%) Query: 75 VQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPK 123 ++ +++ + KR++N+ P+ S SL ++N+ E+ F +P K Sbjct: 265 IKTDKSGHEMLKSAKRRRNLSLSPLISPFSSLDSENVRESGFQGRLPMK 313 >SB_41521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 127 KRSPRTRKVETPRKTPTLRSHKGLENKHSKLKEQ 160 +++ +RK +T RKT T R K +H K ++Q Sbjct: 28 RKTKTSRKTKTSRKTKTSRKTKTKPQEHDKPQDQ 61 >SB_20266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.5 bits (58), Expect = 5.7 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 6/61 (9%) Query: 88 PKRKKNIQPLPIKSKAKSLQN---QNIIEAAFPISVPPKIIRKRSPRTR---KVETPRKT 141 P KKN K AK Q Q + P+ +PP +R+R+ R + R+T Sbjct: 70 PAEKKNASENFTKRYAKCTQRPRAQKHVRTTHPVVIPPPTVRERTKRINPRFALSRTRRT 129 Query: 142 P 142 P Sbjct: 130 P 130 >SB_9398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 27.5 bits (58), Expect = 5.7 Identities = 25/97 (25%), Positives = 39/97 (40%), Gaps = 5/97 (5%) Query: 49 KLSQNTVIGPESKLDDWRVPFKTSAS--VQYEETKRDSCSVPKRKKNIQPLPIKSKAKSL 106 KL Q + P S +D K ++ T D S K + +PL S + + Sbjct: 286 KLDQGRPLKPPSPSNDVISALKLDQGRPLKTPSTSNDVISALKLDQG-RPLKPPSPSNDV 344 Query: 107 QNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKTPT 143 + ++ P+ P +I+ KR P K PR T T Sbjct: 345 ISALKLDQGRPLKPPTRIVEKRDPEREK--NPRATGT 379 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 27.5 bits (58), Expect = 5.7 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 20 KHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDD 64 K E+ +D+L DD D + L DL+ V KL Q + ++ DD Sbjct: 136 KTLERDVDELLDDKKDLQEELADLRPKVEKL-QTQLDATTTQRDD 179 >SB_33129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 7.6 Identities = 21/71 (29%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Query: 50 LSQNTVIGPESKLDDWRVPFKTSASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQ 109 LS TVIG E L W + + +V + T R S+ I P+ S+ + Q Sbjct: 22 LSLTTVIGREPVLSQWYGRRRQNCAVTHPSTNRALLSL---TSVIGREPVLSQWYGRRRQ 78 Query: 110 NIIEAAFPISV 120 N + F I+V Sbjct: 79 NCVRNGFDITV 89 >SB_57444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Query: 50 LSQNTVIGPESKLDDWRVPFKTSASVQYEETKRD---SCSVPKR 90 LS N+VIG E L W + + S +Y + K++ + +PKR Sbjct: 22 LSLNSVIGREPVLSQWYGRRRQNCSCEYFDNKKEMPTAHGIPKR 65 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.1 bits (57), Expect = 7.6 Identities = 20/87 (22%), Positives = 38/87 (43%), Gaps = 4/87 (4%) Query: 23 EKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKR 82 E+K+DKL+ ++ DLK + KL +N E ++ + V ET+R Sbjct: 41 EEKIDKLEGEIEQRATKEKDLKEKMRKLEKNN----ERLANEVKSKNDLLVKVALLETER 96 Query: 83 DSCSVPKRKKNIQPLPIKSKAKSLQNQ 109 + K I+ K +S++++ Sbjct: 97 KRLEEELKTKEKSYSKIEDKCRSMKDK 123 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 27.1 bits (57), Expect = 7.6 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Query: 75 VQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRK 134 V +++K+D + K K+ K K K++QN +A + P K +K R +K Sbjct: 271 VVIKQSKQDEATAIKDSKSESKPASKPKLKAVQN----DAPKKANKPAKKAKKPVKRAKK 326 Query: 135 VETPRKTPTL 144 V +K TL Sbjct: 327 VLNKKKMDTL 336 >SB_39577| Best HMM Match : DUF1213 (HMM E-Value=0.54) Length = 240 Score = 27.1 bits (57), Expect = 7.6 Identities = 32/130 (24%), Positives = 53/130 (40%), Gaps = 11/130 (8%) Query: 23 EKKLDKLQDDVNDHGKTLGDLKTMVS-KLSQNTVIGPESKLDDWRVPFKTSASVQYEETK 81 +K DKL+D ++ + + K S K S+ T SK + KTS + + ++ Sbjct: 40 DKPEDKLEDKPKENQQNKPEDKQQTSPKTSRKT-----SK----KTSQKTSLNASRKTSR 90 Query: 82 RDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKIIRKRSPRTRKVETPRKT 141 R S K + + P + KSL+ PK K SP+T +P+ + Sbjct: 91 RTSLK-RSLKTSPKTSPKTMRMKSLKTSPKTSPEIGPRTSPKTSSKTSPKTSPKSSPKTS 149 Query: 142 PTLRSHKGLE 151 P S L+ Sbjct: 150 PKTSSKTSLK 159 >SB_33374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4475 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/27 (48%), Positives = 15/27 (55%) Query: 119 SVPPKIIRKRSPRTRKVETPRKTPTLR 145 SVP +I R TR TPR+T LR Sbjct: 3685 SVPASLISTREYTTRVARTPRETGALR 3711 >SB_21508| Best HMM Match : THAP (HMM E-Value=0.0086) Length = 218 Score = 27.1 bits (57), Expect = 7.6 Identities = 17/77 (22%), Positives = 31/77 (40%), Gaps = 2/77 (2%) Query: 66 RVPFKTSASVQYEETKRDSCSVPKRKKNIQPLPIKSKAKSLQNQNIIEAAFPISVPPKII 125 +VP S +K ++ V +++K + P+ ++ P + P Sbjct: 143 KVPEPLSQQFPNRVSKSEAIQVYEKRKRHRTTPLYPSVDVQEDMRAAAQEQPTAAPKA-- 200 Query: 126 RKRSPRTRKVETPRKTP 142 RKR PR +K P + P Sbjct: 201 RKREPRCKKCNAPIERP 217 >SB_17538| Best HMM Match : Iso_dh (HMM E-Value=0) Length = 644 Score = 27.1 bits (57), Expect = 7.6 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 4/80 (5%) Query: 20 KHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQ--NTVIGPESKLDDWRVPFKTSASV-- 75 K F K L+K D D GK DL + L++ T+ P +L ++ SV Sbjct: 327 KKFCKALEKACVDTVDQGKMTKDLAACIYGLAKPWGTIEKPPFELGHQKLSADEVESVVD 386 Query: 76 QYEETKRDSCSVPKRKKNIQ 95 + + K+ S +V K+++ ++ Sbjct: 387 RLSQLKKPSSAVNKKRRKVE 406 >SB_51468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1626 Score = 26.6 bits (56), Expect = 10.0 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 4/88 (4%) Query: 64 DWRVPFKTSASVQYEETKRDSCSVPKR-KKNI--QPLPIKSKAKSLQNQNIIEAAFPISV 120 D RVP K Q EE++ SC + K +N+ Q L ++ + +S Q++ + A +V Sbjct: 73 DTRVPSKCVPEGQQEESRSASCKLCKHFSQNMEKQALVLEPRQQSKAKQSLSKGARQSTV 132 Query: 121 PPKIIRKRSPRTRKVETPRKTPTLRSHK 148 K + + + P++ T R+ + Sbjct: 133 NEKGSNQPGIKA-ETSKPKRAGTFRTRR 159 >SB_48907| Best HMM Match : Transket_pyr (HMM E-Value=0) Length = 548 Score = 26.6 bits (56), Expect = 10.0 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 6/69 (8%) Query: 2 ALQRARHTDALQRIMISFKHFEKKLDKLQDDVNDHGKTLGD--LKTM--VSKLSQNT--V 55 A+ A +T +I+ + + ++D +N HGK LGD L + + KL N Sbjct: 152 AMYEAENTKGRPTCIIAKTFKGRGIIGVEDQLNFHGKALGDKGLAAIAEIEKLISNNKHS 211 Query: 56 IGPESKLDD 64 +GP + +DD Sbjct: 212 LGPATVIDD 220 >SB_47823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 671 Score = 26.6 bits (56), Expect = 10.0 Identities = 27/108 (25%), Positives = 51/108 (47%), Gaps = 9/108 (8%) Query: 10 DALQRIMISFKHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNT--VIGPESKLDDWRV 67 D ++ F+ +KK+ K+Q+ N + K + + T +G +S+ +D V Sbjct: 387 DVTEKKQRKFRFSKKKIQKVQELDNSVAEAKDKEKPVNGFKEKETGCQVGSQSEEED-PV 445 Query: 68 PFKTSASVQYEETKR---DSCSVPKRKKNIQ---PLPIKSKAKSLQNQ 109 K+ V+ E T+ +S PKRKK+++ K+KAK + + Sbjct: 446 VAKSEDEVKEEATEEKRTESEEAPKRKKSLKRRLSFSRKNKAKKTEEK 493 >SB_34296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3464 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/59 (27%), Positives = 25/59 (42%) Query: 33 VNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKRDSCSVPKRK 91 +N++ L LK + K + P ++ VP +SA EE +V KRK Sbjct: 281 INNNSDVLARLKEKIQKQKEQASKSPNYDIEPIPVPLNSSAPPPTEEAPFVPKAVTKRK 339 >SB_31746| Best HMM Match : HR1 (HMM E-Value=2.1) Length = 398 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/36 (30%), Positives = 22/36 (61%) Query: 20 KHFEKKLDKLQDDVNDHGKTLGDLKTMVSKLSQNTV 55 K FEKK + L+ ++N + L L+ + ++ ++TV Sbjct: 69 KEFEKKKELLEKEINTRREFLNSLQPRLEEILKSTV 104 >SB_15701| Best HMM Match : MT-A70 (HMM E-Value=1.6e-17) Length = 1178 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 767 RKLDETKQDKVLAGLKGLQSSHSKLGNKIRE 797 >SB_52998| Best HMM Match : DUF827 (HMM E-Value=4.4) Length = 202 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 46 RKLDETKQDKVLAGLKGLQSSHSKLGNKIRE 76 >SB_47731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 114 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 144 >SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1317 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 206 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 236 >SB_38811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 206 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 236 >SB_36352| Best HMM Match : NAP (HMM E-Value=0.5) Length = 246 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 3 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 33 >SB_32316| Best HMM Match : Baculo_p24 (HMM E-Value=1.2) Length = 341 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 206 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 236 >SB_31241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 26.6 bits (56), Expect = 10.0 Identities = 24/93 (25%), Positives = 38/93 (40%), Gaps = 4/93 (4%) Query: 31 DDVNDHGKTLGDLKTMVSKLSQNTVIGPESKLDDWRVPFKTSASVQYEETKRDSCSVPKR 90 D + GKTL + T+ + S LD R KT AS+ T + V K Sbjct: 146 DPAREVGKTLASISTLNPAREVGKTLASISNLDPAREVGKTLASI---STLNPAREVGKT 202 Query: 91 KKNIQPL-PIKSKAKSLQNQNIIEAAFPISVPP 122 +I L P + K+L + + ++ A + P Sbjct: 203 LASISTLNPAREVGKTLASISTLDPAREVGKKP 235 >SB_24634| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00054) Length = 1012 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 182 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 212 >SB_23226| Best HMM Match : Herpes_UL43 (HMM E-Value=1.9) Length = 749 Score = 26.6 bits (56), Expect = 10.0 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 4/88 (4%) Query: 64 DWRVPFKTSASVQYEETKRDSCSVPKR-KKNI--QPLPIKSKAKSLQNQNIIEAAFPISV 120 D RVP K Q EE++ SC + K +N+ Q L ++ + +S Q++ + A +V Sbjct: 73 DTRVPSKCVPEGQQEESRSASCKLCKHFSQNMEKQALVLEPRQQSKAKQSLSKGARQSTV 132 Query: 121 PPKIIRKRSPRTRKVETPRKTPTLRSHK 148 K + + + P++ T R+ + Sbjct: 133 NEKGSNQPGIKA-ETSKPKRAGTFRTRR 159 >SB_16430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 133 RKVETPRKTPTLRSHKGLENKHSKLKEQIVE 163 RK++ ++ L KGL++ HSKL +I E Sbjct: 206 RKLDETKQDKVLADLKGLQSSHSKLGNKIRE 236 >SB_11585| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2) Length = 610 Score = 26.6 bits (56), Expect = 10.0 Identities = 22/77 (28%), Positives = 33/77 (42%), Gaps = 8/77 (10%) Query: 88 PKRKKNIQPLPIKSKAKSLQNQNIIEAAFP-----ISVPPKIIRKRSPRTRKVETPRKTP 142 P R ++Q P+K +L Q + E P S P + +SPRT E P P Sbjct: 307 PSRLVSLQNSPVKMMRSTLSAQTLAENPIPESTDTTSPTPPLTDTKSPRT--PEKPAPLP 364 Query: 143 TLRSHKGLENKHSKLKE 159 T R + +K K+ + Sbjct: 365 T-RPQTPIFSKTQKIAD 380 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.313 0.129 0.359 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,392,154 Number of Sequences: 59808 Number of extensions: 211256 Number of successful extensions: 785 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 31 Number of HSP's that attempted gapping in prelim test: 736 Number of HSP's gapped (non-prelim): 80 length of query: 163 length of database: 16,821,457 effective HSP length: 77 effective length of query: 86 effective length of database: 12,216,241 effective search space: 1050596726 effective search space used: 1050596726 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 56 (26.6 bits)
- SilkBase 1999-2023 -