SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001972-TA|BGIBMGA001972-PA|IPR008934|Acid
phosphatase/vanadium-dependent haloperoxidase,
IPR000326|Phosphoesterase, PA-phosphatase related
         (197 letters)

Database: bee 
           429 sequences; 140,377 total letters

Searching.....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    21   7.8  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 21.0 bits (42), Expect = 7.8
 Identities = 11/48 (22%), Positives = 21/48 (43%)

Query: 11  PNTVYFQLWAVEAMLYQDDEYNMKKRKMLASAKTAGLIYRDYIYGAVV 58
           P  ++   W V     ++ E   ++ +M  +A      YR + Y +VV
Sbjct: 577 PRALWPTEWKVRPSTVEEREEFRRQERMRYAAPHKAFTYRMHGYASVV 624


  Database: bee
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 140,377
  Number of sequences in database:  429
  
Lambda     K      H
   0.326    0.136    0.444 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,970
Number of Sequences: 429
Number of extensions: 2004
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 197
length of database: 140,377
effective HSP length: 55
effective length of query: 142
effective length of database: 116,782
effective search space: 16583044
effective search space used: 16583044
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.7 bits)
S2: 42 (21.0 bits)

- SilkBase 1999-2023 -