BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001971-TA|BGIBMGA001971-PA|undefined
(55 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_6818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.1
>SB_6818| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 1784
Score = 27.1 bits (57), Expect = 2.1
Identities = 13/37 (35%), Positives = 20/37 (54%)
Query: 3 MNNKFINVALRSMAQVETASQPALSGVPAVEMQAKHS 39
M+ KFI + + T S A+SGV A+++ HS
Sbjct: 404 MDYKFIKLIEADVVAKLTGSSIAISGVSAIKLDGSHS 440
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.321 0.131 0.372
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,432,419
Number of Sequences: 59808
Number of extensions: 29748
Number of successful extensions: 187
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 186
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 16,821,457
effective HSP length: 35
effective length of query: 20
effective length of database: 14,728,177
effective search space: 294563540
effective search space used: 294563540
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 52 (25.0 bits)
- SilkBase 1999-2023 -