GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001971-TA|BGIBMGA001971-PA|undefined
         (55 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    22   2.5  

>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
           transcriptase protein.
          Length = 1049

 Score = 21.8 bits (44), Expect = 2.5
 Identities = 11/50 (22%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 1   MKMNNKFIN--VALRSMAQVETASQPALSGVPAVEMQAKHSVLWHLLIDL 48
           + M+  FI+  + L ++AQ++ +  P   G+P+  ++   + +  +L  L
Sbjct: 534 INMSTPFIDSEIVLSALAQLKPSFAPGPDGIPSTVLKRCQTTVAPILAKL 583


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.321    0.131    0.372 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 45,640
Number of Sequences: 2123
Number of extensions: 932
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 516,269
effective HSP length: 34
effective length of query: 21
effective length of database: 444,087
effective search space:  9325827
effective search space used:  9325827
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.5 bits)
S2: 40 (20.2 bits)