BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001971-TA|BGIBMGA001971-PA|undefined (55 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006695-4|AAF39977.1| 453|Caenorhabditis elegans Hypothetical ... 27 2.1 >AC006695-4|AAF39977.1| 453|Caenorhabditis elegans Hypothetical protein W06H8.2 protein. Length = 453 Score = 26.6 bits (56), Expect = 2.1 Identities = 11/30 (36%), Positives = 16/30 (53%) Query: 5 NKFINVALRSMAQVETASQPALSGVPAVEM 34 N+F+ AL M + S P +GVP E+ Sbjct: 29 NRFLKAALTEMLSIFDPSTPGANGVPTQEI 58 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.321 0.131 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,100,382 Number of Sequences: 27539 Number of extensions: 25664 Number of successful extensions: 42 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 41 Number of HSP's gapped (non-prelim): 1 length of query: 55 length of database: 12,573,161 effective HSP length: 36 effective length of query: 19 effective length of database: 11,581,757 effective search space: 220053383 effective search space used: 220053383 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -