BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001971-TA|BGIBMGA001971-PA|undefined
(55 letters)
Database: celegans
27,539 sequences; 12,573,161 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AC006695-4|AAF39977.1| 453|Caenorhabditis elegans Hypothetical ... 27 2.1
>AC006695-4|AAF39977.1| 453|Caenorhabditis elegans Hypothetical
protein W06H8.2 protein.
Length = 453
Score = 26.6 bits (56), Expect = 2.1
Identities = 11/30 (36%), Positives = 16/30 (53%)
Query: 5 NKFINVALRSMAQVETASQPALSGVPAVEM 34
N+F+ AL M + S P +GVP E+
Sbjct: 29 NRFLKAALTEMLSIFDPSTPGANGVPTQEI 58
Database: celegans
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 12,573,161
Number of sequences in database: 27,539
Lambda K H
0.321 0.131 0.372
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,100,382
Number of Sequences: 27539
Number of extensions: 25664
Number of successful extensions: 42
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 41
Number of HSP's gapped (non-prelim): 1
length of query: 55
length of database: 12,573,161
effective HSP length: 36
effective length of query: 19
effective length of database: 11,581,757
effective search space: 220053383
effective search space used: 220053383
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 51 (24.6 bits)
- SilkBase 1999-2023 -