BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001970-TA|BGIBMGA001970-PA|undefined (184 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40959-1|AAA81765.1| 228|Caenorhabditis elegans Hypothetical pr... 30 1.1 Z48583-3|CAA88471.2| 595|Caenorhabditis elegans Hypothetical pr... 29 1.5 >U40959-1|AAA81765.1| 228|Caenorhabditis elegans Hypothetical protein B0310.1 protein. Length = 228 Score = 29.9 bits (64), Expect = 1.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Query: 44 LASHVKVSLGSIGTPLPITSERFIGKTIERVWKLTDAFMYTLKYL 88 L + V IGTPL +T +GK + VW+ T ++ T+ Y+ Sbjct: 104 LGKLIAVLYALIGTPLFLTVIGQLGKMVTSVWQGTTLWIVTIVYI 148 >Z48583-3|CAA88471.2| 595|Caenorhabditis elegans Hypothetical protein F54B3.3 protein. Length = 595 Score = 29.5 bits (63), Expect = 1.5 Identities = 14/35 (40%), Positives = 22/35 (62%) Query: 1 MNLPEIKAYEEQAIDTVVSVINRATEKIGTRLNLF 35 +NL ++K +EE+ TV+ I + E IG+ LN F Sbjct: 203 VNLEQMKLHEEENRKTVIEKIKTSGELIGSGLNQF 237 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.325 0.138 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,141,382 Number of Sequences: 27539 Number of extensions: 160287 Number of successful extensions: 439 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 437 Number of HSP's gapped (non-prelim): 2 length of query: 184 length of database: 12,573,161 effective HSP length: 77 effective length of query: 107 effective length of database: 10,452,658 effective search space: 1118434406 effective search space used: 1118434406 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -