BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001970-TA|BGIBMGA001970-PA|undefined (184 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) 32 0.33 SB_10773| Best HMM Match : TatC (HMM E-Value=0.31) 28 4.0 >SB_9412| Best HMM Match : Peptidase_M1 (HMM E-Value=3.1e-07) Length = 1844 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/38 (36%), Positives = 23/38 (60%) Query: 28 IGTRLNLFQLALSRKNLASHVKVSLGSIGTPLPITSER 65 + T ++F +++N+ASHV LG +P P TS+R Sbjct: 1253 VDTSTSVFDRISTKENVASHVSRPLGGSTSPSPFTSKR 1290 >SB_10773| Best HMM Match : TatC (HMM E-Value=0.31) Length = 380 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 4/71 (5%) Query: 112 YPIPQATVSVFFRIEDKHIEPL--EIRGVPRMWFRIEGQQVDHDVQFVALTADWILAVLQ 169 YP+ +V+FR +HIE + +IR R W I + + H + V T + +A+ Sbjct: 178 YPLFYLVGTVYFR--KRHIERVLGQIRLTRRYWNHIRNKLLKHCIYIVLFTVVFPVALRA 235 Query: 170 MKMKLFQRIEK 180 +M + EK Sbjct: 236 CEMNIPTMTEK 246 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.325 0.138 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,389,525 Number of Sequences: 59808 Number of extensions: 194317 Number of successful extensions: 422 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 421 Number of HSP's gapped (non-prelim): 2 length of query: 184 length of database: 16,821,457 effective HSP length: 78 effective length of query: 106 effective length of database: 12,156,433 effective search space: 1288581898 effective search space used: 1288581898 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -