BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001969-TA|BGIBMGA001969-PA|IPR000884|Thrombospondin, type I, IPR006025|Peptidase M, neutral zinc metallopeptidases, zinc-binding site, IPR001590|Peptidase M12B, ADAM/reprolysin (754 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 25 3.0 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 25 3.0 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 24 4.0 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 329 QSRCLLDHGNSAGQLDHSAEGILPGE 354 ++RC+ +HG + Q+D +G L E Sbjct: 42 KARCMSEHGTTQAQIDDVDKGNLVNE 67 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 329 QSRCLLDHGNSAGQLDHSAEGILPGE 354 ++RC+ +HG + Q+D +G L E Sbjct: 42 KARCMSEHGTTQAQIDDVDKGNLVNE 67 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 24.2 bits (50), Expect = 4.0 Identities = 12/34 (35%), Positives = 15/34 (44%) Query: 295 CDPSAFLMSPTLGSGKITWSQCSKNYLQKFLDTV 328 C+P ++SPT W Q K L L TV Sbjct: 272 CEPQVVIVSPTRELTIQIWQQIVKFSLNSILKTV 305 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.135 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 219,997 Number of Sequences: 429 Number of extensions: 9744 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 3 length of query: 754 length of database: 140,377 effective HSP length: 63 effective length of query: 691 effective length of database: 113,350 effective search space: 78324850 effective search space used: 78324850 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -