BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001969-TA|BGIBMGA001969-PA|IPR000884|Thrombospondin, type I, IPR006025|Peptidase M, neutral zinc metallopeptidases, zinc-binding site, IPR001590|Peptidase M12B, ADAM/reprolysin (754 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 26 1.1 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 26 1.1 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 23 5.8 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Query: 521 TARGKSSGPWRRAAEWVAASGCHYHCIAPGAGLR 554 T R GP R AA + C YH +APG +R Sbjct: 597 TWRRNFHGPHRLAAR---SRRCCYHAVAPGTDIR 627 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Query: 521 TARGKSSGPWRRAAEWVAASGCHYHCIAPGAGLR 554 T R GP R AA + C YH +APG +R Sbjct: 489 TWRRNFHGPHRLAAR---SRRCCYHAVAPGTDIR 519 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 13 IHPLPERFHTDDTKAHIIIKRRMVDTNNHLEEN 45 + PLP F+ K H I + ++ NN + N Sbjct: 28 VQPLPRHFNPPSDKLHHPIHQTVIYHNNPRDPN 60 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,754 Number of Sequences: 317 Number of extensions: 8330 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 3 length of query: 754 length of database: 114,650 effective HSP length: 62 effective length of query: 692 effective length of database: 94,996 effective search space: 65737232 effective search space used: 65737232 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -