BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001968-TA|BGIBMGA001968-PA|undefined (146 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.8 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 114 NKNTAFMLAHEIAHRSKRAWCLKPEENNKYILV 146 +K T + +I RA+C K + N +V Sbjct: 79 SKGTTLFMTSQIKKNVTRAYCNKKIDRNLQFVV 111 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/33 (27%), Positives = 15/33 (45%) Query: 114 NKNTAFMLAHEIAHRSKRAWCLKPEENNKYILV 146 +K T + +I RA+C K + N +V Sbjct: 79 SKGTTLFMTSQIKKNVTRAYCNKKIDRNLQFVV 111 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.324 0.135 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,034 Number of Sequences: 317 Number of extensions: 1403 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 146 length of database: 114,650 effective HSP length: 51 effective length of query: 95 effective length of database: 98,483 effective search space: 9355885 effective search space used: 9355885 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -