Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001966-TA|BGIBMGA001966-PA|IPR002086|Aldehyde
dehydrogenase, IPR012394|Aldehyde dehydrogenase NAD(P)-dependent,
IPR005225|Small GTP-binding protein domain,
IPR009078|Ferritin/ribonucleotide reductase-like, IPR003577|Ras small
GTPase, Ras type, IPR003579|Ras small GTPase, Rab type, IPR003578|Ras
small GTPase, Rho type, IPR002041|GTP-binding nuclear protein Ran,
IPR001806|Ras GTPase, IPR013753|Ras
         (750 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory pro...    24   3.3  

>DQ855503-1|ABH88190.1|  124|Tribolium castaneum chemosensory
           protein 17 protein.
          Length = 124

 Score = 24.2 bits (50), Expect = 3.3
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 679 LRNDPATINELRKMKQEPVKPQEGRAMAEKINAFAYLECSA---KSKEGVREV 728
           L+ND  T N L  + ++     EG  + + I      EC+    K KEGVR+V
Sbjct: 33  LKNDRLTKNYLDCILEKGKCTPEGEELKKDIPDALQNECAKCNEKHKEGVRKV 85


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.137    0.412 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,818
Number of Sequences: 317
Number of extensions: 8493
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 1
length of query: 750
length of database: 114,650
effective HSP length: 62
effective length of query: 688
effective length of database: 94,996
effective search space: 65357248
effective search space used: 65357248
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 47 (23.0 bits)