BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001963-TA|BGIBMGA001963-PA|IPR000886|Endoplasmic reticulum targeting sequence, IPR002018|Carboxylesterase, type B (409 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1338 - 29440373-29440534,29440993-29441083,29441799-294419... 36 0.059 05_07_0305 - 29097478-29097598,29097766-29097866,29098136-290982... 33 0.41 01_06_0036 + 25786530-25786756,25788000-25788076,25788538-257886... 31 1.7 08_02_0585 + 19014674-19014871,19014987-19015132,19016742-190168... 30 3.9 06_03_0715 - 23823427-23823525,23823616-23823822,23823907-238240... 29 5.1 05_01_0547 - 4774320-4776089,4776823-4777028,4777563-4777818 29 5.1 03_04_0169 - 17959262-17959304,17959441-17959532,17959682-179597... 29 6.7 01_05_0724 - 24612712-24612852,24612985-24613038,24613340-246134... 29 6.7 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 29 8.9 >06_03_1338 - 29440373-29440534,29440993-29441083,29441799-29441942, 29442094-29442159,29442589-29442729,29443077-29443178, 29443264-29443338,29443469-29443549,29443670-29443739, 29444063-29444139,29444392-29444660 Length = 425 Score = 35.9 bits (79), Expect = 0.059 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query: 7 LRDLVLGLEWINGNIEKFGGDRERITLMGSQGGA-AAVDLLMHSSAKK 53 + D G+ ++ NI +GGD ERI L+G GA A L+H + K+ Sbjct: 202 VEDASQGIAFVCNNIASYGGDPERIYLVGQSAGAHIAACTLLHQAIKE 249 >05_07_0305 - 29097478-29097598,29097766-29097866,29098136-29098288, 29098404-29098542,29098649-29098719,29099022-29099333, 29099605-29099903,29100011-29100271,29100365-29100471, 29100588-29100739,29100816-29100970,29102946-29103141, 29103340-29103468,29103540-29103641,29103736-29103889, 29103970-29104058 Length = 846 Score = 33.1 bits (72), Expect = 0.41 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Query: 91 SSGHKLIAKLNEVPPDNIVSKDFHACQKEFSKEYQRSIVTFGPVVEKQPDGLITEYPEDS 150 S H + ++ P +I +DFHA +K Y+ I T V+EK + +I YPE Sbjct: 71 SKAHNFVERVKACP--DISREDFHALLNVLAKYYKNEIKTSEEVLEK-VERIIGNYPEFL 127 Query: 151 EQ 152 E+ Sbjct: 128 EE 129 >01_06_0036 + 25786530-25786756,25788000-25788076,25788538-25788625, 25788706-25788786,25788866-25788940,25789048-25789149, 25789589-25789726,25791559-25791585,25791696-25791786, 25792423-25792584 Length = 355 Score = 31.1 bits (67), Expect = 1.7 Identities = 13/32 (40%), Positives = 18/32 (56%) Query: 9 DLVLGLEWINGNIEKFGGDRERITLMGSQGGA 40 D G+ ++ NI +GGD RI L+G GA Sbjct: 196 DASQGISYVCNNIASYGGDPNRIYLVGQSAGA 227 >08_02_0585 + 19014674-19014871,19014987-19015132,19016742-19016844, 19017064-19017250,19017368-19017461,19017570-19017723, 19018076-19018192,19018276-19018296,19019096-19019209, 19019970-19020152,19021032-19021239,19021326-19021447, 19021559-19021656,19021875-19022052,19022130-19022244, 19022331-19022398,19022526-19022603,19023737-19023814, 19023897-19024082 Length = 815 Score = 29.9 bits (64), Expect = 3.9 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Query: 265 DLFSDFNENKLNIMKMSSVEGVSWGAAGTDELCYLFKCPNLKETYLKHDNTMSE-DRKTQ 323 DLF D+ + K+ V + A + + +ET L +D +S K Q Sbjct: 239 DLFKDYFATPYPLPKLDMVAIPDFAAGAMEN----YGLVTYRETALLYDELLSSASNKQQ 294 Query: 324 MKIVKLWSNFAKYRNPTPDNDETLAGLR 351 + + + + F ++ N T DET +GLR Sbjct: 295 VSYLAVEALFPEWNNWTQFLDETTSGLR 322 >06_03_0715 - 23823427-23823525,23823616-23823822,23823907-23824017, 23824124-23824322,23824410-23824495,23824940-23825098, 23825204-23825302,23825385-23826578,23826666-23826734, 23828042-23828812 Length = 997 Score = 29.5 bits (63), Expect = 5.1 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 4/57 (7%) Query: 234 YTGDVLTAYSVNCAVSAYAKRSRSPIYYYHFDLFSDFNENKLNIMKMSSVEGVSWGA 290 Y DVL A S+ A+ + P L + ++N LN +K S V+G WGA Sbjct: 746 YQWDVLAARSI----WAFGPEKQGPNILLDDTLSVEVDKNLLNAVKDSIVQGFQWGA 798 >05_01_0547 - 4774320-4776089,4776823-4777028,4777563-4777818 Length = 743 Score = 29.5 bits (63), Expect = 5.1 Identities = 11/36 (30%), Positives = 23/36 (63%) Query: 76 RERAFNLGEVMNRTASSGHKLIAKLNEVPPDNIVSK 111 R++ FNL E +NR S +LI ++ ++ ++ ++K Sbjct: 448 RDKVFNLSEELNRVKISNQQLITQITKLTDESNIAK 483 >03_04_0169 - 17959262-17959304,17959441-17959532,17959682-17959759, 17959938-17960075,17960174-17960302,17960556-17960685, 17960797-17960974,17961177-17961315,17961399-17961488, 17961633-17961794,17961966-17962130,17962250-17962387, 17962827-17963006,17963405-17963533,17963878-17964113, 17964233-17964395,17965260-17965628,17965724-17965828 Length = 887 Score = 29.1 bits (62), Expect = 6.7 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 5 AGLRDLVLG-LEWINGNIEKFGGDRERITLMGSQGGAA 41 AGL D +L L W+ GN+ GD R L+ + GAA Sbjct: 75 AGLWDEILAALTWVEGNMGAVLGDPRRPLLLSVRSGAA 112 >01_05_0724 - 24612712-24612852,24612985-24613038,24613340-24613429, 24613499-24613780,24613926-24614119,24614379-24614508, 24614610-24614690,24614766-24614891,24615019-24615076, 24615319-24615380,24615753-24615803,24615946-24616065, 24616280-24616403,24616832-24616920,24617304-24617396, 24617910-24618063,24618673-24619178 Length = 784 Score = 29.1 bits (62), Expect = 6.7 Identities = 18/95 (18%), Positives = 41/95 (43%), Gaps = 3/95 (3%) Query: 49 SSAKKLFSAVILQGGSSWSGAYLHDNVRERAFNLGEVMNRTASSGHKLIAKLNEVPPDNI 108 ++A++ F V+ SW + D +R + + + L+ +LN+ P+++ Sbjct: 114 AAARRFFDWVVSGDWMSWWPFWRPDRRLQRLIDDADANPADPAKQSALLHELNKFSPEDV 173 Query: 109 VSK---DFHACQKEFSKEYQRSIVTFGPVVEKQPD 140 + + HA EY R+++ + + PD Sbjct: 174 IKRFEQRSHAVDSRGVAEYLRALILTNGIADYLPD 208 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 28.7 bits (61), Expect = 8.9 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Query: 341 PDNDETLAGLRWSPYTVENEEYLH-MDND-FKMKTELNKSKFKFWDDFI 387 P+N + L W +E + L ++ D K EL K++ KFWDD + Sbjct: 479 PENGDGLTPFPWPARLMEPPKRLEGVEMDAHSSKKELFKAETKFWDDIV 527 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.136 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,996,027 Number of Sequences: 37544 Number of extensions: 579618 Number of successful extensions: 1165 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 1160 Number of HSP's gapped (non-prelim): 11 length of query: 409 length of database: 14,793,348 effective HSP length: 84 effective length of query: 325 effective length of database: 11,639,652 effective search space: 3782886900 effective search space used: 3782886900 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -