BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001962-TA|BGIBMGA001962-PA|IPR000387|Tyrosine specific protein phosphatase and dual specificity protein phosphatase, IPR000242|Tyrosine specific protein phosphatase, IPR003595|Protein tyrosine phosphatase, catalytic region (1140 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 27 0.87 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 6.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 6.1 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 24 6.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 27.1 bits (57), Expect = 0.87 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 4/83 (4%) Query: 675 EDDYEPEFVDSPTYLCDRPTPELPPRAGSSDRVLEPRDAPRGPSRAHSQGVFERRLP-KI 733 +D E E P+ RP PE P R + D L P + RG + S + P I Sbjct: 1346 QDSSEDESYRGPSASGGRPVPERPERVPTVD--LSPSPSDRGRNDDGSDRLTSPPTPLSI 1403 Query: 734 YKFGLMDKSKRASSSALYERAPR 756 + G D+ S+ L +R+ R Sbjct: 1404 SRAGSRDEDSTRDSTKL-DRSSR 1425 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.2 bits (50), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 64 FWRMIWQERAAAIVMLTKTFDFIKVMCVQY 93 +W++ W AI + TF+ IK + V+Y Sbjct: 490 WWKICWTITTPAICVGVFTFNIIKFVPVKY 519 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.2 bits (50), Expect = 6.1 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 64 FWRMIWQERAAAIVMLTKTFDFIKVMCVQY 93 +W++ W AI + TF+ IK + V+Y Sbjct: 543 WWKICWTITTPAICVGVFTFNIIKFVPVKY 572 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 24.2 bits (50), Expect = 6.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Query: 390 YPPFWPEGRH 399 YPPFW E +H Sbjct: 109 YPPFWDEDQH 118 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.132 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 324,036 Number of Sequences: 429 Number of extensions: 14577 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 14 Number of HSP's gapped (non-prelim): 6 length of query: 1140 length of database: 140,377 effective HSP length: 65 effective length of query: 1075 effective length of database: 112,492 effective search space: 120928900 effective search space used: 120928900 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -