BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001961-TA|BGIBMGA001961-PA|undefined (114 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 4.0 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 20 5.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 20 7.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 20 7.0 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 20.6 bits (41), Expect = 4.0 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 5/71 (7%) Query: 16 QRKHRSKSSTRYDMEKKPKKKDMRTSGTTSLVSIPNSIKLTMLNSGLISFETFQIVPLYL 75 Q++H + S + K K + T + + VSI N+ S S + P +L Sbjct: 128 QKQHNQQQSVEKSSKLKNKSAPILTKTSPTPVSINNNTS----TSSSASSPSVTAAP-HL 182 Query: 76 QNLENVISPSI 86 ++ N I P + Sbjct: 183 RDSPNYIKPQL 193 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 20.2 bits (40), Expect = 5.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 48 SIPNSIKLTMLNSGLISF 65 S+ NSI++ + S +ISF Sbjct: 70 SLLNSIQIRCIESNMISF 87 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 19.8 bits (39), Expect = 7.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 30 EKKPKKKD 37 EKKP+KKD Sbjct: 1053 EKKPEKKD 1060 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 19.8 bits (39), Expect = 7.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Query: 30 EKKPKKKD 37 EKKP+KKD Sbjct: 1053 EKKPEKKD 1060 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.130 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,873 Number of Sequences: 317 Number of extensions: 685 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 114 length of database: 114,650 effective HSP length: 49 effective length of query: 65 effective length of database: 99,117 effective search space: 6442605 effective search space used: 6442605 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -