BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001961-TA|BGIBMGA001961-PA|undefined (114 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U56813-1|AAC50933.1| 608|Homo sapiens polycystwin protein. 30 1.9 U50928-1|AAC50520.1| 968|Homo sapiens PKD2 protein. 30 1.9 U17195-1|AAA92354.2| 2319|Homo sapiens A-kinase anchor protein p... 30 1.9 BC112926-1|AAI12927.1| 1306|Homo sapiens ARHGEF10 protein protein. 30 1.9 BC112263-1|AAI12264.1| 968|Homo sapiens polycystin 2 protein. 30 1.9 BC112261-1|AAI12262.1| 968|Homo sapiens polycystin 2 protein. 30 1.9 AF009205-1|AAB71662.1| 988|Homo sapiens unknown protein. 30 1.9 AF004873-1|AAC16004.1| 968|Homo sapiens autosomal dominant poly... 30 1.9 AB002309-1|BAA20770.2| 2324|Homo sapiens KIAA0311 protein. 30 1.9 AB002292-1|BAA20754.2| 1405|Homo sapiens KIAA0294 protein. 30 1.9 M22734-1|AAA60048.1| 1089|Homo sapiens platelet-derived growth f... 29 3.3 M21574-1|AAA96715.1| 1089|Homo sapiens platelet-derived growth f... 29 3.3 D50017-1|BAA08742.1| 1089|Homo sapiens alpha-platelet-derived gr... 29 3.3 AY229892-1|AAP69563.1| 849|Homo sapiens FIP1L1/PDGFRA fusion pr... 29 3.3 Z84485-2|CAI21669.1| 1205|Homo sapiens bromodomain and PHD finge... 29 4.4 U50078-1|AAD12586.1| 4861|Homo sapiens p532 protein. 29 4.4 BC117387-1|AAI17388.1| 935|Homo sapiens BRPF3 protein protein. 29 4.4 BC033652-1|AAH33652.2| 602|Homo sapiens BRPF3 protein protein. 29 4.4 AB033112-1|BAA86600.1| 1214|Homo sapiens KIAA1286 protein protein. 29 4.4 AF213987-1|AAM00184.2| 1163|Homo sapiens MCEF protein protein. 28 7.7 AF197927-1|AAF18981.1| 1163|Homo sapiens AF5q31 protein protein. 28 7.7 AB209547-1|BAD92784.1| 907|Homo sapiens ALL1 fused gene from 5q... 28 7.7 >U56813-1|AAC50933.1| 608|Homo sapiens polycystwin protein. Length = 608 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/62 (27%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Query: 58 LNSGLISFETFQIVPLYLQNLENVISPSIGAVDSLVVRI----RQCYKRRSLL-RVRNGI 112 ++SG +S+E FQ++ + +E+ I + +D+++V++ R KRR +L R+ +G+ Sbjct: 470 ISSG-VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 528 Query: 113 ID 114 + Sbjct: 529 AE 530 >U50928-1|AAC50520.1| 968|Homo sapiens PKD2 protein. Length = 968 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/62 (27%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Query: 58 LNSGLISFETFQIVPLYLQNLENVISPSIGAVDSLVVRI----RQCYKRRSLL-RVRNGI 112 ++SG +S+E FQ++ + +E+ I + +D+++V++ R KRR +L R+ +G+ Sbjct: 830 ISSG-VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 888 Query: 113 ID 114 + Sbjct: 889 AE 890 >U17195-1|AAA92354.2| 2319|Homo sapiens A-kinase anchor protein protein. Length = 2319 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 8/80 (10%) Query: 35 KKDMRTSGTTSLVSIPNSIKLTML------NSGLISFETFQIV-PLYLQNLENVISPSIG 87 K +M S T SLV P+ KL ++ NS + ++++ + + NLEN + I Sbjct: 418 KPEMSRS-TPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGNGNLENTVKFHIK 476 Query: 88 AVDSLVVRIRQCYKRRSLLR 107 + S + R+ CYK +S L+ Sbjct: 477 EISSSLGRLNDCYKEKSRLK 496 >BC112926-1|AAI12927.1| 1306|Homo sapiens ARHGEF10 protein protein. Length = 1306 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 1 MSSRTGPRGTSVATSQRKHRSKSSTRYDMEKKP 33 +SS +G S +S +HRS+ ST YD+ K P Sbjct: 1218 LSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDP 1250 >BC112263-1|AAI12264.1| 968|Homo sapiens polycystin 2 protein. Length = 968 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/62 (27%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Query: 58 LNSGLISFETFQIVPLYLQNLENVISPSIGAVDSLVVRI----RQCYKRRSLL-RVRNGI 112 ++SG +S+E FQ++ + +E+ I + +D+++V++ R KRR +L R+ +G+ Sbjct: 830 ISSG-VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 888 Query: 113 ID 114 + Sbjct: 889 AE 890 >BC112261-1|AAI12262.1| 968|Homo sapiens polycystin 2 protein. Length = 968 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/62 (27%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Query: 58 LNSGLISFETFQIVPLYLQNLENVISPSIGAVDSLVVRI----RQCYKRRSLL-RVRNGI 112 ++SG +S+E FQ++ + +E+ I + +D+++V++ R KRR +L R+ +G+ Sbjct: 830 ISSG-VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 888 Query: 113 ID 114 + Sbjct: 889 AE 890 >AF009205-1|AAB71662.1| 988|Homo sapiens unknown protein. Length = 988 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 1 MSSRTGPRGTSVATSQRKHRSKSSTRYDMEKKP 33 +SS +G S +S +HRS+ ST YD+ K P Sbjct: 900 LSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDP 932 >AF004873-1|AAC16004.1| 968|Homo sapiens autosomal dominant polycystic kidney disease type II protein protein. Length = 968 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/62 (27%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Query: 58 LNSGLISFETFQIVPLYLQNLENVISPSIGAVDSLVVRI----RQCYKRRSLL-RVRNGI 112 ++SG +S+E FQ++ + +E+ I + +D+++V++ R KRR +L R+ +G+ Sbjct: 830 ISSG-VSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGV 888 Query: 113 ID 114 + Sbjct: 889 AE 890 >AB002309-1|BAA20770.2| 2324|Homo sapiens KIAA0311 protein. Length = 2324 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 8/80 (10%) Query: 35 KKDMRTSGTTSLVSIPNSIKLTML------NSGLISFETFQIV-PLYLQNLENVISPSIG 87 K +M S T SLV P+ KL ++ NS + ++++ + + NLEN + I Sbjct: 423 KPEMSRS-TPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGNGNLENTVKFHIK 481 Query: 88 AVDSLVVRIRQCYKRRSLLR 107 + S + R+ CYK +S L+ Sbjct: 482 EISSSLGRLNDCYKEKSRLK 501 >AB002292-1|BAA20754.2| 1405|Homo sapiens KIAA0294 protein. Length = 1405 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/33 (42%), Positives = 20/33 (60%) Query: 1 MSSRTGPRGTSVATSQRKHRSKSSTRYDMEKKP 33 +SS +G S +S +HRS+ ST YD+ K P Sbjct: 1317 LSSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDP 1349 >M22734-1|AAA60048.1| 1089|Homo sapiens platelet-derived growth factor A receptor protein. Length = 1089 Score = 29.1 bits (62), Expect = 3.3 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Query: 16 QRKHRSKSS----TRYDMEKKPKKKDMRTSGTTSLVSIPNSIKLTMLNSGLISFETFQI 70 +RK SK S + YD KKK M S +L+S NS LT+L+ L+SF T+Q+ Sbjct: 747 ERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLD--LLSF-TYQV 802 >M21574-1|AAA96715.1| 1089|Homo sapiens platelet-derived growth factor receptor A chain protein. Length = 1089 Score = 29.1 bits (62), Expect = 3.3 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Query: 16 QRKHRSKSS----TRYDMEKKPKKKDMRTSGTTSLVSIPNSIKLTMLNSGLISFETFQI 70 +RK SK S + YD KKK M S +L+S NS LT+L+ L+SF T+Q+ Sbjct: 747 ERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLD--LLSF-TYQV 802 >D50017-1|BAA08742.1| 1089|Homo sapiens alpha-platelet-derived growth factor receptor protein. Length = 1089 Score = 29.1 bits (62), Expect = 3.3 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Query: 16 QRKHRSKSS----TRYDMEKKPKKKDMRTSGTTSLVSIPNSIKLTMLNSGLISFETFQI 70 +RK SK S + YD KKK M S +L+S NS LT+L+ L+SF T+Q+ Sbjct: 747 ERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLD--LLSF-TYQV 802 >AY229892-1|AAP69563.1| 849|Homo sapiens FIP1L1/PDGFRA fusion protein protein. Length = 849 Score = 29.1 bits (62), Expect = 3.3 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Query: 16 QRKHRSKSS----TRYDMEKKPKKKDMRTSGTTSLVSIPNSIKLTMLNSGLISFETFQI 70 +RK SK S + YD KKK M S +L+S NS LT+L+ L+SF T+Q+ Sbjct: 507 ERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLD--LLSF-TYQV 562 >Z84485-2|CAI21669.1| 1205|Homo sapiens bromodomain and PHD finger containing, 3 protein. Length = 1205 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 6/63 (9%) Query: 20 RSKSSTRYDMEKKPKKKDMRTSGTTSLVSIPN--SIKLTMLNSGLISFETFQIVPLYLQN 77 +SK S + ++K+P++ T T ++++P S +L + SGL +FQ ++Q Sbjct: 447 KSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIPSYRLNKICSGL----SFQRKNQFMQR 502 Query: 78 LEN 80 L N Sbjct: 503 LHN 505 >U50078-1|AAD12586.1| 4861|Homo sapiens p532 protein. Length = 4861 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 4/38 (10%) Query: 11 SVATSQRKHRSKSSTRYDMEKKPKKK---DMRTSGTTS 45 S ++KHR +S + D+E+KP+ + DMRT G TS Sbjct: 2410 STKRHEKKHRHESEEKGDVEQKPESESALDMRT-GLTS 2446 >BC117387-1|AAI17388.1| 935|Homo sapiens BRPF3 protein protein. Length = 935 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 6/63 (9%) Query: 20 RSKSSTRYDMEKKPKKKDMRTSGTTSLVSIPN--SIKLTMLNSGLISFETFQIVPLYLQN 77 +SK S + ++K+P++ T T ++++P S +L + SGL +FQ ++Q Sbjct: 447 KSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIPSYRLNKICSGL----SFQRKNQFMQR 502 Query: 78 LEN 80 L N Sbjct: 503 LHN 505 >BC033652-1|AAH33652.2| 602|Homo sapiens BRPF3 protein protein. Length = 602 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 6/63 (9%) Query: 20 RSKSSTRYDMEKKPKKKDMRTSGTTSLVSIPN--SIKLTMLNSGLISFETFQIVPLYLQN 77 +SK S + ++K+P++ T T ++++P S +L + SGL +FQ ++Q Sbjct: 423 KSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIPSYRLNKICSGL----SFQRKNQFMQR 478 Query: 78 LEN 80 L N Sbjct: 479 LHN 481 >AB033112-1|BAA86600.1| 1214|Homo sapiens KIAA1286 protein protein. Length = 1214 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 6/63 (9%) Query: 20 RSKSSTRYDMEKKPKKKDMRTSGTTSLVSIPN--SIKLTMLNSGLISFETFQIVPLYLQN 77 +SK S + ++K+P++ T T ++++P S +L + SGL +FQ ++Q Sbjct: 456 KSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIPSYRLNKICSGL----SFQRKNQFMQR 511 Query: 78 LEN 80 L N Sbjct: 512 LHN 514 >AF213987-1|AAM00184.2| 1163|Homo sapiens MCEF protein protein. Length = 1163 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 16 QRKHRSKSSTRYDMEKKPKKKDMRTSG 42 +RKH+++ R KKPK +D ++G Sbjct: 765 KRKHKNEDDNRASESKKPKTEDKNSAG 791 >AF197927-1|AAF18981.1| 1163|Homo sapiens AF5q31 protein protein. Length = 1163 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 16 QRKHRSKSSTRYDMEKKPKKKDMRTSG 42 +RKH+++ R KKPK +D ++G Sbjct: 765 KRKHKNEDDNRASESKKPKTEDKNSAG 791 >AB209547-1|BAD92784.1| 907|Homo sapiens ALL1 fused gene from 5q31 variant protein. Length = 907 Score = 27.9 bits (59), Expect = 7.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Query: 16 QRKHRSKSSTRYDMEKKPKKKDMRTSG 42 +RKH+++ R KKPK +D ++G Sbjct: 772 KRKHKNEDDNRASESKKPKTEDKNSAG 798 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.316 0.130 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,889,652 Number of Sequences: 224733 Number of extensions: 475262 Number of successful extensions: 1920 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 1904 Number of HSP's gapped (non-prelim): 30 length of query: 114 length of database: 73,234,838 effective HSP length: 80 effective length of query: 34 effective length of database: 55,256,198 effective search space: 1878710732 effective search space used: 1878710732 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -