BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001961-TA|BGIBMGA001961-PA|undefined (114 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 25 0.17 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 20 6.3 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 25.4 bits (53), Expect = 0.17 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 2 SSRTGPRGTSVATSQRKHRSKSSTRYDME---KKPKKKDMRTSGTTSLVSIPNS 52 S RG S +S H SKS T+ DM+ + + DM + ++ IP++ Sbjct: 389 SGENNSRGHSGQSSSHHHGSKSWTQEDMDAALEALRNHDMSLTKASATFGIPST 442 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.2 bits (40), Expect = 6.3 Identities = 7/28 (25%), Positives = 14/28 (50%) Query: 1 MSSRTGPRGTSVATSQRKHRSKSSTRYD 28 M +GPRG ++ ++ + RY+ Sbjct: 713 MCRTSGPRGVAIVSASTARSEQFLCRYE 740 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.130 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,318 Number of Sequences: 429 Number of extensions: 1008 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 114 length of database: 140,377 effective HSP length: 50 effective length of query: 64 effective length of database: 118,927 effective search space: 7611328 effective search space used: 7611328 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.7 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -