BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001955-TA|BGIBMGA001955-PA|IPR007757|MT-A70 (158 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 25 0.85 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 2.6 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 6.0 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 25.4 bits (53), Expect = 0.85 Identities = 16/43 (37%), Positives = 20/43 (46%) Query: 97 VSIPSALHSHKPPLLDLLKPYINKEQPRILELFARYLLPNTTS 139 VS+ L ++ PLL L K KEQ E F N+TS Sbjct: 92 VSVGQLLWGYEDPLLKLAKDVFPKEQKLPCEEFGLMYGKNSTS 134 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 2.6 Identities = 11/18 (61%), Positives = 13/18 (72%), Gaps = 1/18 (5%) Query: 107 KPPLLDLLKPYINKEQPR 124 +PPL LK +INKE PR Sbjct: 426 RPPL-HALKDFINKEPPR 442 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/23 (34%), Positives = 11/23 (47%) Query: 10 IPLSNLLSSNCLVAVWCTNSPAN 32 +P N NC+ + C PAN Sbjct: 488 VPTKNASFRNCVTSAACVLGPAN 510 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.321 0.137 0.437 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,172 Number of Sequences: 2123 Number of extensions: 7331 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 3 length of query: 158 length of database: 516,269 effective HSP length: 59 effective length of query: 99 effective length of database: 391,012 effective search space: 38710188 effective search space used: 38710188 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -