GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001954-TA|BGIBMGA001954-PA|IPR004088|KH, type 1,
IPR004087|KH
         (311 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    31   0.055

>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
            structural protein protein.
          Length = 1645

 Score = 30.7 bits (66), Expect = 0.055
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 42   SRTACVLDFDNSLKTGARLKIFSNSAPQSSE----RIVQLIGKPDSIVSGVREVLDLV 95
            SR +C+L+ D  L      + FS+S  Q ++    ++ +L G  ++I  GVR ++D++
Sbjct: 1096 SRLSCILELDTMLANHLHREAFSSSELQKAKDRLAKLQELSGGLNTIWKGVRWLMDVI 1153


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.315    0.135    0.393 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 222,056
Number of Sequences: 2123
Number of extensions: 7587
Number of successful extensions: 14
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 13
Number of HSP's gapped (non-prelim): 1
length of query: 311
length of database: 516,269
effective HSP length: 64
effective length of query: 247
effective length of database: 380,397
effective search space: 93958059
effective search space used: 93958059
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 48 (23.4 bits)