BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001952-TA|BGIBMGA001952-PA|undefined (111 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) fa... 39 9e-04 At3g22790.1 68416.m02873 kinase interacting family protein simil... 38 0.001 At1g66840.1 68414.m07597 expressed protein contains Pfam profile... 35 0.011 At4g37380.1 68417.m05293 pentatricopeptide (PPR) repeat-containi... 34 0.018 At3g05830.1 68416.m00654 expressed protein 34 0.018 At4g14760.1 68417.m02271 M protein repeat-containing protein con... 34 0.024 At4g14410.2 68417.m02224 basic helix-loop-helix (bHLH) family pr... 34 0.024 At4g14410.1 68417.m02223 basic helix-loop-helix (bHLH) family pr... 34 0.024 At5g60210.1 68418.m07547 cytoplasmic linker protein-related cont... 33 0.032 At5g55820.1 68418.m06956 expressed protein 33 0.032 At1g71360.1 68414.m08237 expressed protein low similarity to PIR... 33 0.032 At2g38580.1 68415.m04739 expressed protein ; expression supporte... 33 0.043 At1g77580.2 68414.m09032 myosin heavy chain-related low similari... 33 0.043 At1g77580.1 68414.m09033 myosin heavy chain-related low similari... 33 0.043 At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR016... 33 0.043 At5g52410.2 68418.m06502 expressed protein 33 0.056 At5g52410.1 68418.m06503 expressed protein 33 0.056 At5g36780.1 68418.m04406 hypothetical protein 33 0.056 At5g36690.1 68418.m04391 hypothetical protein 33 0.056 At4g14840.1 68417.m02281 expressed protein 33 0.056 At2g33240.1 68415.m04072 myosin, putative similar to myosin (GI:... 33 0.056 At2g31900.1 68415.m03897 myosin family protein contains Pfam pro... 33 0.056 At1g69460.1 68414.m07981 emp24/gp25L/p24 family protein similar ... 33 0.056 At4g15790.1 68417.m02403 expressed protein 32 0.074 At5g23890.1 68418.m02806 expressed protein weak similarity to SP... 32 0.098 At5g12150.1 68418.m01426 pleckstrin homology (PH) domain-contain... 32 0.098 At2g30880.2 68415.m03764 pleckstrin homology (PH) domain-contain... 32 0.098 At2g30880.1 68415.m03763 pleckstrin homology (PH) domain-contain... 32 0.098 At1g80610.1 68414.m09459 expressed protein 32 0.098 At5g38150.1 68418.m04598 expressed protein 31 0.13 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 31 0.13 At3g05130.1 68416.m00557 expressed protein ; expression supporte... 31 0.13 At2g03290.1 68415.m00284 emp24/gp25L/p24 family protein similar ... 31 0.13 At4g31570.1 68417.m04483 expressed protein 31 0.17 At4g17220.1 68417.m02590 expressed protein 31 0.17 At4g09950.1 68417.m01628 avirulence-responsive family protein / ... 31 0.17 At3g52490.1 68416.m05772 heat shock protein-related contains sim... 31 0.17 At3g22520.1 68416.m02846 expressed protein 31 0.17 At2g34270.1 68415.m04193 hypothetical protein and genscan 31 0.17 At1g05320.1 68414.m00539 myosin-related similar to non-muscle my... 31 0.17 At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (T... 31 0.23 At5g07890.1 68418.m00910 myosin heavy chain-related contains wea... 31 0.23 At1g63300.1 68414.m07156 expressed protein similar to Intracellu... 31 0.23 At5g66310.1 68418.m08360 kinesin motor family protein contains P... 30 0.30 At5g58000.1 68418.m07256 phosphatase-related weak similarity to ... 30 0.30 At5g27330.1 68418.m03263 expressed protein 30 0.30 At5g23700.1 68418.m02778 hypothetical protein 30 0.30 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 30 0.30 At5g11140.1 68418.m01302 hypothetical protein 30 0.30 At4g02800.1 68417.m00380 expressed protein similar to A. thalian... 30 0.30 At3g12020.1 68416.m01490 kinesin motor protein-related similar t... 30 0.30 At2g38720.1 68415.m04755 microtubule associated protein (MAP65/A... 30 0.30 At2g31820.1 68415.m03886 ankyrin repeat family protein contains ... 30 0.30 At2g30500.1 68415.m03715 kinase interacting family protein simil... 30 0.30 At1g63640.2 68414.m07198 kinesin motor protein-related C-termina... 30 0.30 At1g63640.1 68414.m07197 kinesin motor protein-related C-termina... 30 0.30 At1g13650.2 68414.m01605 expressed protein 30 0.30 At1g13650.1 68414.m01604 expressed protein 30 0.30 At1g06170.2 68414.m00649 basic helix-loop-helix (bHLH) family pr... 30 0.30 At1g06170.1 68414.m00648 basic helix-loop-helix (bHLH) family pr... 30 0.30 At5g41780.1 68418.m05087 myosin heavy chain-related weak similar... 30 0.40 At4g11100.1 68417.m01802 expressed protein 30 0.40 At2g46180.1 68415.m05742 intracellular protein transport protein... 30 0.40 At2g34730.1 68415.m04265 myosin heavy chain-related low similari... 30 0.40 At1g79830.1 68414.m09326 expressed protein weak similarity to TA... 30 0.40 At1g65010.1 68414.m07368 expressed protein similar to endosome-a... 30 0.40 At1g64330.1 68414.m07290 myosin heavy chain-related similar to m... 30 0.40 At1g26690.1 68414.m03251 emp24/gp25L/p24 family protein similar ... 30 0.40 At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related simil... 30 0.40 At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein... 29 0.53 At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein... 29 0.53 At5g48660.1 68418.m06022 expressed protein ; expression supporte... 29 0.53 At5g03060.1 68418.m00254 expressed protein ; expression supporte... 29 0.53 At4g30630.1 68417.m04344 expressed protein 29 0.53 At4g27260.1 68417.m03913 auxin-responsive GH3 family protein sim... 29 0.53 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 29 0.53 At2g22560.1 68415.m02674 kinase interacting protein-related simi... 29 0.53 At1g50660.1 68414.m05696 expressed protein similar to liver stag... 29 0.53 At5g59390.1 68418.m07442 XH/XS domain-containing protein contain... 29 0.69 At5g57910.1 68418.m07244 expressed protein similar to unknown pr... 29 0.69 At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 29 0.69 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 29 0.69 At5g04420.1 68418.m00435 kelch repeat-containing protein low sim... 29 0.69 At3g58840.1 68416.m06558 expressed protein 29 0.69 At2g42480.1 68415.m05255 meprin and TRAF homology domain-contain... 29 0.69 At1g59540.1 68414.m06694 kinesin motor protein-related similar t... 29 0.69 At1g56040.1 68414.m06434 U-box domain-containing protein contain... 29 0.69 At1g54930.1 68414.m06273 zinc knuckle (CCHC-type) family protein... 29 0.69 At1g03080.1 68414.m00282 kinase interacting family protein simil... 29 0.69 At5g62350.1 68418.m07826 invertase/pectin methylesterase inhibit... 29 0.92 At5g55860.1 68418.m06963 expressed protein contains Pfam profile... 29 0.92 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 29 0.92 At5g07820.1 68418.m00896 expressed protein 29 0.92 At4g30790.1 68417.m04362 expressed protein 29 0.92 At4g04396.1 68417.m00632 hypothetical protein 29 0.92 At4g03000.2 68417.m00408 expressed protein contains similarity t... 29 0.92 At4g03000.1 68417.m00407 expressed protein contains similarity t... 29 0.92 At3g55060.1 68416.m06115 expressed protein contains weak similar... 29 0.92 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 29 0.92 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 29 0.92 At2g34580.1 68415.m04248 hypothetical protein 29 0.92 At1g27920.1 68414.m03421 microtubule associated protein (MAP65/A... 29 0.92 At1g05640.1 68414.m00585 ankyrin repeat family protein contains ... 29 0.92 At5g64180.1 68418.m08058 expressed protein 28 1.2 At5g62250.1 68418.m07816 microtubule associated protein (MAP65/A... 28 1.2 At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-... 28 1.2 At5g37130.1 68418.m04457 tetratricopeptide repeat (TPR)-containi... 28 1.2 At4g13540.1 68417.m02111 expressed protein 28 1.2 At3g53350.3 68416.m05888 myosin heavy chain-related low similari... 28 1.2 At3g53350.2 68416.m05887 myosin heavy chain-related low similari... 28 1.2 At3g53350.1 68416.m05886 myosin heavy chain-related low similari... 28 1.2 At2g42470.1 68415.m05254 meprin and TRAF homology domain-contain... 28 1.2 At2g25320.1 68415.m03029 meprin and TRAF homology domain-contain... 28 1.2 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 28 1.2 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 28 1.2 At1g76720.1 68414.m08929 eukaryotic translation initiation facto... 28 1.2 At1g67230.1 68414.m07652 expressed protein 28 1.2 At1g53490.1 68414.m06064 bZIP protein 28 1.2 At1g29270.1 68414.m03579 expressed protein 28 1.2 At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)... 28 1.2 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 28 1.6 At5g41140.1 68418.m05001 expressed protein 28 1.6 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 28 1.6 At4g36740.1 68417.m05213 homeobox-leucine zipper family protein ... 28 1.6 At4g18880.1 68417.m02784 heat shock transcription factor 21 (HSF... 28 1.6 At3g51720.1 68416.m05671 expressed protein contains Pfam PF05701... 28 1.6 At3g47640.1 68416.m05186 basic helix-loop-helix (bHLH) family pr... 28 1.6 At3g07190.1 68416.m00857 expressed protein 28 1.6 At3g02930.1 68416.m00288 expressed protein ; expression support... 28 1.6 At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1) ... 28 1.6 At1g64690.1 68414.m07333 expressed protein 28 1.6 At1g20100.1 68414.m02515 expressed protein 28 1.6 At5g59760.1 68418.m07490 hypothetical protein 27 2.1 At5g51600.1 68418.m06397 microtubule associated protein (MAP65/A... 27 2.1 At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 27 2.1 At5g42570.1 68418.m05183 expressed protein low similarity to SP|... 27 2.1 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 27 2.1 At5g13130.1 68418.m01504 hypothetical protein low similarity to ... 27 2.1 At4g01480.1 68417.m00191 inorganic pyrophosphatase, putative [so... 27 2.1 At3g23210.1 68416.m02926 basic helix-loop-helix (bHLH) family pr... 27 2.1 At3g12540.1 68416.m01560 expressed protein contains Pfam profile... 27 2.1 At3g10180.1 68416.m01219 kinesin motor protein-related similar t... 27 2.1 At2g38830.1 68415.m04771 tumor susceptibility protein-related co... 27 2.1 At2g31150.1 68415.m03803 expressed protein 27 2.1 At2g18550.1 68415.m02161 homeobox-leucine zipper family protein ... 27 2.1 At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat... 27 2.1 At5g65460.1 68418.m08232 kinesin motor protein-related contains ... 27 2.8 At5g65180.2 68418.m08199 expressed protein contains Pfam domain,... 27 2.8 At5g65180.1 68418.m08198 expressed protein contains Pfam domain,... 27 2.8 At5g51520.1 68418.m06389 invertase/pectin methylesterase inhibit... 27 2.8 At5g45190.1 68418.m05547 cyclin family protein similar to cyclin... 27 2.8 At5g43900.1 68418.m05368 myosin heavy chain (MYA2) nearly identi... 27 2.8 At4g36120.1 68417.m05141 expressed protein 27 2.8 At4g32190.1 68417.m04581 centromeric protein-related low similar... 27 2.8 At4g27595.1 68417.m03964 protein transport protein-related low s... 27 2.8 At4g02710.1 68417.m00366 kinase interacting family protein simil... 27 2.8 At4g00695.1 68417.m00095 hypothetical protein 27 2.8 At3g58360.1 68416.m06505 meprin and TRAF homology domain-contain... 27 2.8 At3g44050.1 68416.m04718 kinesin motor protein-related KLP2 prot... 27 2.8 At2g35330.1 68415.m04332 zinc finger (C3HC4-type RING finger) pr... 27 2.8 At2g23490.1 68415.m02804 hypothetical protein 27 2.8 At2g16900.1 68415.m01946 expressed protein 27 2.8 At1g68880.1 68414.m07883 bZIP transcription factor family protei... 27 2.8 At1g58210.1 68414.m06610 kinase interacting family protein simil... 27 2.8 At1g51070.1 68414.m05741 basic helix-loop-helix (bHLH) family pr... 27 2.8 At1g04160.1 68414.m00406 myosin family protein contains Pfam pro... 27 2.8 At5g67240.1 68418.m08475 exonuclease family protein contains exo... 27 3.7 At5g61200.1 68418.m07677 hypothetical protein 27 3.7 At5g53020.1 68418.m06585 expressed protein 27 3.7 At5g06830.1 68418.m00772 expressed protein contains Pfam profile... 27 3.7 At5g01910.1 68418.m00110 hypothetical protein 27 3.7 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 27 3.7 At4g35110.2 68417.m04989 expressed protein 27 3.7 At4g35110.1 68417.m04988 expressed protein 27 3.7 At4g06672.1 68417.m01069 hypothetical protein contains a non-con... 27 3.7 At3g51570.1 68416.m05648 disease resistance protein (TIR-NBS-LRR... 27 3.7 At3g19370.1 68416.m02457 expressed protein 27 3.7 At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101)... 27 3.7 At2g47020.2 68415.m05874 peptide chain release factor, putative ... 27 3.7 At2g41350.1 68415.m05104 expressed protein 27 3.7 At2g20970.1 68415.m02481 hypothetical protein 27 3.7 At2g04038.1 68415.m00382 bZIP transcription factor family protei... 27 3.7 At1g64320.1 68414.m07289 myosin heavy chain-related similar to m... 27 3.7 At1g36160.1 68414.m04495 acetyl-CoA carboxylase 1 (ACC1) nearly ... 27 3.7 At1g32530.1 68414.m04014 zinc finger (C3HC4-type RING finger) fa... 27 3.7 At1g32330.1 68414.m03983 heat shock transcription factor family ... 27 3.7 At1g22882.1 68414.m02857 expressed protein 27 3.7 At1g14010.1 68414.m01654 emp24/gp25L/p24 family protein similar ... 27 3.7 At1g01050.1 68414.m00005 inorganic pyrophosphatase, putative [so... 27 3.7 At5g66700.1 68418.m08408 homeobox-leucine zipper family protein ... 26 4.9 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 26 4.9 At5g65685.1 68418.m08268 soluble glycogen synthase-related conta... 26 4.9 At5g27630.1 68418.m03310 acyl-CoA binding family protein similar... 26 4.9 At5g15690.1 68418.m01835 hypothetical protein very low similarit... 26 4.9 At5g03415.1 68418.m00294 DPB-1 transcription factor, putative (D... 26 4.9 At4g31110.1 68417.m04415 wall-associated kinase, putative simila... 26 4.9 At4g27610.2 68417.m03968 expressed protein 26 4.9 At4g27610.1 68417.m03967 expressed protein 26 4.9 At4g24970.1 68417.m03578 ATP-binding region, ATPase-like domain-... 26 4.9 At4g23800.1 68417.m03422 high mobility group (HMG1/2) family pro... 26 4.9 At4g11420.1 68417.m01840 eukaryotic translation initiation facto... 26 4.9 At3g61390.2 68416.m06872 U-box domain-containing protein several... 26 4.9 At3g61390.1 68416.m06871 U-box domain-containing protein several... 26 4.9 At3g56270.1 68416.m06253 expressed protein contains Pfam PF05701... 26 4.9 At3g32070.1 68416.m04077 hypothetical protein 26 4.9 At3g26125.1 68416.m03258 cytochrome P450, putative 26 4.9 At3g13190.2 68416.m01651 myosin heavy chain-related contains wea... 26 4.9 At3g13190.1 68416.m01650 myosin heavy chain-related contains wea... 26 4.9 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 26 4.9 At2g40840.1 68415.m05042 glycoside hydrolase family 77 protein c... 26 4.9 At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel... 26 4.9 At2g19410.1 68415.m02264 protein kinase family protein contains ... 26 4.9 At1g78430.1 68414.m09139 tropomyosin-related similar to Tropomyo... 26 4.9 At1g68790.1 68414.m07863 expressed protein 26 4.9 At1g65070.1 68414.m07377 DNA mismatch repair MutS family protein... 26 4.9 At1g58400.1 68414.m06644 disease resistance protein (CC-NBS-LRR ... 26 4.9 At1g45976.1 68414.m05206 expressed protein 26 4.9 At1g21900.1 68414.m02741 emp24/gp25L/p24 family protein similar ... 26 4.9 At1g12430.1 68414.m01436 armadillo/beta-catenin repeat family pr... 26 4.9 At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, p... 26 4.9 At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:... 26 4.9 At5g54680.1 68418.m06809 basic helix-loop-helix (bHLH) family pr... 26 6.5 At5g54110.1 68418.m06737 vesicle-associated membrane family prot... 26 6.5 At5g54070.1 68418.m06731 heat shock transcription factor family ... 26 6.5 At5g20580.2 68418.m02444 expressed protein predicted protein, Ar... 26 6.5 At5g20580.1 68418.m02443 expressed protein predicted protein, Ar... 26 6.5 At5g19900.1 68418.m02368 PRLI-interacting factor, putative stron... 26 6.5 At5g12900.1 68418.m01480 expressed protein 26 6.5 At5g03720.1 68418.m00332 heat shock transcription factor family ... 26 6.5 At4g17010.1 68417.m02566 expressed protein 26 6.5 At3g52250.1 68416.m05742 myb family transcription factor contain... 26 6.5 At3g47460.1 68416.m05161 SMC2-like condensin, putative similar t... 26 6.5 At3g29700.1 68416.m03744 expressed protein 26 6.5 At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family pr... 26 6.5 At3g04850.1 68416.m00526 tesmin/TSO1-like CXC domain-containing ... 26 6.5 At2g38040.2 68415.m04670 acetyl co-enzyme A carboxylase carboxyl... 26 6.5 At2g38040.1 68415.m04669 acetyl co-enzyme A carboxylase carboxyl... 26 6.5 At2g37420.1 68415.m04589 kinesin motor protein-related 26 6.5 At2g18760.1 68415.m02184 SNF2 domain-containing protein / helica... 26 6.5 At2g05410.1 68415.m00569 ubiquitin-specific protease-related / m... 26 6.5 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 26 6.5 At1g31440.1 68414.m03850 SH3 domain-containing protein 1 (SH3P1)... 26 6.5 At1g22060.1 68414.m02759 expressed protein 26 6.5 At1g03970.1 68414.m00383 G-box binding factor 4 (GBF4) identical... 26 6.5 At5g16820.2 68418.m01971 heat shock factor protein 3 (HSF3) / he... 25 8.6 At5g16820.1 68418.m01970 heat shock factor protein 3 (HSF3) / he... 25 8.6 At5g10470.1 68418.m01213 kinesin motor protein-related TH65 prot... 25 8.6 At4g37080.2 68417.m05252 expressed protein contains Pfam profile... 25 8.6 At4g37080.1 68417.m05253 expressed protein contains Pfam profile... 25 8.6 At4g35985.1 68417.m05121 senescence/dehydration-associated prote... 25 8.6 At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70... 25 8.6 At4g08336.1 68417.m01377 hypothetical protein 25 8.6 At4g01180.1 68417.m00156 XH/XS domain-containing protein contain... 25 8.6 At3g52115.1 68416.m05720 hypothetical protein 25 8.6 At3g48860.2 68416.m05337 expressed protein 25 8.6 At3g48860.1 68416.m05336 expressed protein 25 8.6 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 25 8.6 At3g23890.1 68416.m03002 DNA topoisomerase, ATP-hydrolyzing / DN... 25 8.6 At3g12550.1 68416.m01562 XH/XS domain-containing protein / XS zi... 25 8.6 At2g46860.1 68415.m05847 inorganic pyrophosphatase, putative [so... 25 8.6 At2g45460.1 68415.m05654 forkhead-associated domain-containing p... 25 8.6 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 25 8.6 At2g24930.1 68415.m02981 Ulp1 protease family protein contains P... 25 8.6 At2g04320.1 68415.m00427 expressed protein 25 8.6 At1g69810.1 68414.m08032 WRKY family transcription factor 25 8.6 At1g53380.1 68414.m06051 expressed protein contains Pfam profile... 25 8.6 At1g17140.2 68414.m02089 tropomyosin-related similar to Tropomyo... 25 8.6 At1g17140.1 68414.m02088 tropomyosin-related similar to Tropomyo... 25 8.6 At1g12650.1 68414.m01469 expressed protein similar to KED (GI:80... 25 8.6 At1g05690.1 68414.m00590 TAZ zinc finger family protein / BTB/PO... 25 8.6 At1g02080.1 68414.m00130 transcriptional regulator-related conta... 25 8.6 >At1g55255.1 68414.m06311 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 383 Score = 38.7 bits (86), Expect = 9e-04 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 1/104 (0%) Query: 2 SCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMK 61 S C E+L K + + + + E+EVL+L+ + +E + +E+E + + EDM+ Sbjct: 94 SACQERLATAKAEIAELRTQLDLSEREVLELKEGIKVKEQEAEASIAEMETIGQAYEDMQ 153 Query: 62 EQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 Q Q++ + I ++S N+HLS+ +++ EK Sbjct: 154 TQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSE-KQVMEK 196 >At3g22790.1 68416.m02873 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1694 Score = 38.3 bits (85), Expect = 0.001 Identities = 24/91 (26%), Positives = 45/91 (49%), Gaps = 1/91 (1%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 L+ K + S+ + K E+EV + N+ A EE+ LK E++ L +R + + EQ++ Sbjct: 512 LETQKCEISSLKEIKEKLEEEVARHINQSSAFQEEIRRLKDEIDSLNKRYQAIMEQVNLA 571 Query: 68 QNQISMIEICRISEEAKSRAHLSNLNSHLSD 98 + C + + + L+ L +H SD Sbjct: 572 GLDPKSL-ACSVRKLQDENSKLTELCNHQSD 601 >At1g66840.1 68414.m07597 expressed protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827); expression supported by MPSS Length = 607 Score = 35.1 bits (77), Expect = 0.011 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 6/81 (7%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 ++L +KL V++ K++ EKEV++L ++ L+ L SLK EV+ E E + Sbjct: 119 QELSKLKLDVVYVSREKVVAEKEVMELESRMEENLKLLESLKLEVDVANE------EHVL 172 Query: 66 QTQNQISMIEICRISEEAKSR 86 +I ++ C+ EE + + Sbjct: 173 VEVAKIEALKECKEVEEQREK 193 >At4g37380.1 68417.m05293 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 632 Score = 34.3 bits (75), Expect = 0.018 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 4/85 (4%) Query: 29 VLKLRN--KERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSR 86 V K+RN KE+ +++E G E+E + S+++ +M+ +ISE KS Sbjct: 482 VAKVRNLMKEKGIVKEPGISTIEIENKVHEFRAGDREHSKSKEIYTMLR--KISERIKSH 539 Query: 87 AHLSNLNSHLSDFERLFEKGFILIH 111 ++ N N+ L D E ++ + +H Sbjct: 540 GYVPNTNTVLQDLEETEKEQSLQVH 564 >At3g05830.1 68416.m00654 expressed protein Length = 336 Score = 34.3 bits (75), Expect = 0.018 Identities = 21/92 (22%), Positives = 45/92 (48%), Gaps = 5/92 (5%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 D+ +KF+ +N+ +K++E+ KL+++ R + G K + + L +LE + + Sbjct: 203 DVSPMKFERMNRLVEVKDEEITKLKDEIRLM---SGQWKHKTKELESQLEKQRRTDQDLK 259 Query: 69 NQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 ++ +E C +EA+S+ D E Sbjct: 260 KKVLKLEFC--LQEARSQTRKLQRKGERRDME 289 >At4g14760.1 68417.m02271 M protein repeat-containing protein contains Pfam profile: PF02370 M protein repeat Length = 1676 Score = 33.9 bits (74), Expect = 0.024 Identities = 17/60 (28%), Positives = 32/60 (53%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 L++ K + + K K E+EV K N+ AL E+ +K ++ + R + + +Q+S T Sbjct: 475 LEIQKNEISCLKKMKEKLEEEVAKQMNQSSALQVEIHCVKGNIDSMNRRYQKLIDQVSLT 534 Score = 30.7 bits (66), Expect = 0.23 Identities = 22/80 (27%), Positives = 41/80 (51%), Gaps = 7/80 (8%) Query: 30 LKLRNKERALLEELG-SLKSEVEYLRERLEDMKEQISQTQNQISMI------EICRISEE 82 +K ++ ALLE ++K E E L ++ +++SQ QN+I + E R SE Sbjct: 351 IKTVEEQCALLESFNQTMKVEAENLAHKMSAKDQELSQKQNEIEKLQAVMQEEQLRFSEL 410 Query: 83 AKSRAHLSNLNSHLSDFERL 102 S +L +L+S + +++ Sbjct: 411 GASLRNLESLHSQSQEEQKV 430 Score = 30.7 bits (66), Expect = 0.23 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAK 84 +E E+L+ + +A E L EVE LR+ ED + + + QIS + +E + Sbjct: 1127 REMEILEAEHMLKATNNENEELHKEVEELRKDYEDSRRMRANLEWQISELSDVAGRQEEE 1186 Query: 85 SRAHLSNLNSHLSDFERLFEK 105 R L+ LN +L + K Sbjct: 1187 IR-KLNALNENLESEVQFLNK 1206 Score = 25.4 bits (53), Expect = 8.6 Identities = 8/30 (26%), Positives = 21/30 (70%) Query: 47 KSEVEYLRERLEDMKEQISQTQNQISMIEI 76 K+E+ L++ E ++E++++ NQ S +++ Sbjct: 479 KNEISCLKKMKEKLEEEVAKQMNQSSALQV 508 >At4g14410.2 68417.m02224 basic helix-loop-helix (bHLH) family protein Length = 277 Score = 33.9 bits (74), Expect = 0.024 Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 E LKL + LLEE+ SLK+E LRE +K +T+ Q+ Sbjct: 178 EALKLEETNQKLLEEIKSLKAEKNELREEKLVLKADKEKTEQQL 221 >At4g14410.1 68417.m02223 basic helix-loop-helix (bHLH) family protein Length = 283 Score = 33.9 bits (74), Expect = 0.024 Identities = 18/44 (40%), Positives = 25/44 (56%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 E LKL + LLEE+ SLK+E LRE +K +T+ Q+ Sbjct: 184 EALKLEETNQKLLEEIKSLKAEKNELREEKLVLKADKEKTEQQL 227 >At5g60210.1 68418.m07547 cytoplasmic linker protein-related contains weak similarity to cytoplasmic linker protein CLIP-170 (GI:2905649) [Gallus gallus] Length = 588 Score = 33.5 bits (73), Expect = 0.032 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Query: 19 NKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLE--DMKEQISQTQNQISMIEI 76 N ++K+ E L+ R + + EE+ SL+ EVE LR LE D K+Q + + Sbjct: 322 NHEILLKDYESLR-RGESNEMDEEVSSLRCEVERLRAALEASDKKDQEGNVEASSRLRIQ 380 Query: 77 CRISEEAK-SRAHLSNLNSHLSDFE 100 + E K +++ + L + L D E Sbjct: 381 AELQSELKIAKSEIDELKARLMDKE 405 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/79 (24%), Positives = 32/79 (40%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRA 87 ++ + + E +++ SEV+ LR L D + +NQ+ EI EA + Sbjct: 204 QIEMVASSEAGHVKQAELYNSEVQLLRGNLMDTLFHVENFRNQLKDCEISEAETEALATE 263 Query: 88 HLSNLNSHLSDFERLFEKG 106 L L + E L G Sbjct: 264 TLRQLENAKKAVEELKSDG 282 >At5g55820.1 68418.m06956 expressed protein Length = 1826 Score = 33.5 bits (73), Expect = 0.032 Identities = 21/90 (23%), Positives = 42/90 (46%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 KLK +++ + +E+E LK + E+ EE K ++ +E K++ + + + Sbjct: 1540 KLKKEAMKLERAKQEQENLKKQEIEKKKKEEDRKKKEAEMAWKQEMEKKKKEEERKRKEF 1599 Query: 72 SMIEICRISEEAKSRAHLSNLNSHLSDFER 101 M + R EE R + ++DF+R Sbjct: 1600 EMADRKRQREEEDKRLKEAKKRQRIADFQR 1629 Score = 25.4 bits (53), Expect = 8.6 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 9/87 (10%) Query: 7 KLDLVKLKFKSVNKRKIMKEK--EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 KL+ K + +++ K++I K+K E K + E A +E+ K E E R+ E M ++ Sbjct: 1547 KLERAKQEQENLKKQEIEKKKKEEDRKKKEAEMAWKQEMEKKKKEEERKRKEFE-MADRK 1605 Query: 65 SQTQNQISMIEICRISEEAKSRAHLSN 91 Q + + ++ EAK R +++ Sbjct: 1606 RQREEEDKRLK------EAKKRQRIAD 1626 >At1g71360.1 68414.m08237 expressed protein low similarity to PIR|JC7185 chromosome 1 C1orf9 protein [Homo sapiens] Length = 459 Score = 33.5 bits (73), Expect = 0.032 Identities = 16/73 (21%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 ++++ ++L+ + + +R+ +KE +++R + EL ++E E ++ERLE + E++ Sbjct: 343 KEVETMRLEVEGMKEREENTKKEAMEMRKWRMRVETELEKAENEKEKVKERLEQVLERLE 402 Query: 66 QTQNQ-ISMIEIC 77 + + + + IC Sbjct: 403 WMEKKGVVVFTIC 415 Score = 25.4 bits (53), Expect = 8.6 Identities = 22/103 (21%), Positives = 47/103 (45%), Gaps = 1/103 (0%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLE-ELGSLKSEVEYLRERLEDMKEQISQ 66 LD+ +S + + +K + K + E + E E+ +++ EVE ++ER E+ K++ + Sbjct: 309 LDVSLSVLESYLEERSLKYGMIFKEMDLEASKREKEVETMRLEVEGMKEREENTKKEAME 368 Query: 67 TQNQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEKGFIL 109 + +E E + L L E + +KG ++ Sbjct: 369 MRKWRMRVETELEKAENEKEKVKERLEQVLERLEWMEKKGVVV 411 >At2g38580.1 68415.m04739 expressed protein ; expression supported by MPSS Length = 377 Score = 33.1 bits (72), Expect = 0.043 Identities = 16/75 (21%), Positives = 41/75 (54%), Gaps = 3/75 (4%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI---EICRISEE 82 E+ +++ +NK LL E+ S ++++ L + ++ + + ++ + E ++EE Sbjct: 106 EERLVQYKNKNDMLLREMSSTEAQMRQLLDERSTFTQKEASLEKKVQQLQHDEESLVAEE 165 Query: 83 AKSRAHLSNLNSHLS 97 SR +S+LN+ ++ Sbjct: 166 KSSREMISSLNNEIA 180 >At1g77580.2 68414.m09032 myosin heavy chain-related low similarity to SP|P08799 Myosin II heavy chain, non muscle {Dictyostelium discoideum} Length = 779 Score = 33.1 bits (72), Expect = 0.043 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query: 22 KIMKEKEVLKLR---NKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 K+ EKE LK N+E+A++ SL +E+E L R ++++EQ+ + + Sbjct: 403 KLEAEKEELKSEVKCNREKAVVHVENSLAAEIEVLTSRTKELEEQLEKLE 452 Score = 29.5 bits (63), Expect = 0.53 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 EKL+ K + KS + K +EK V+ + N A +E L S E+E E+LE K ++ Sbjct: 402 EKLEAEKEELKS--EVKCNREKAVVHVENSLAAEIEVLTSRTKELEEQLEKLEAEKVEL 458 Score = 28.3 bits (60), Expect = 1.2 Identities = 21/95 (22%), Positives = 44/95 (46%), Gaps = 5/95 (5%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ---NQ 70 + + + K+ E EV N+E A+ + SL +E+E L R++ ++E++ + + ++ Sbjct: 447 QLEKLEAEKVELESEVKC--NREEAVAQVENSLATEIEVLTCRIKQLEEKLEKLEVEKDE 504 Query: 71 ISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 + C E+ R L + + E EK Sbjct: 505 LKSEVKCNREVESTLRFELEAIACEKMELENKLEK 539 Score = 27.5 bits (58), Expect = 2.1 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 4/70 (5%) Query: 36 ERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSH 95 E +L E+ L S ++ L E+LE ++ + + +N++ C E + L S Sbjct: 338 ENSLASEIEVLTSRIKELEEKLEKLEAEKHELENEVK----CNREEAVVHIENSEVLTSR 393 Query: 96 LSDFERLFEK 105 + E EK Sbjct: 394 TKELEEKLEK 403 >At1g77580.1 68414.m09033 myosin heavy chain-related low similarity to SP|P08799 Myosin II heavy chain, non muscle {Dictyostelium discoideum} Length = 629 Score = 33.1 bits (72), Expect = 0.043 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 3/50 (6%) Query: 22 KIMKEKEVLKLR---NKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 K+ EKE LK N+E+A++ SL +E+E L R ++++EQ+ + + Sbjct: 369 KLEAEKEELKSEVKCNREKAVVHVENSLAAEIEVLTSRTKELEEQLEKLE 418 Score = 29.5 bits (63), Expect = 0.53 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 EKL+ K + KS + K +EK V+ + N A +E L S E+E E+LE K ++ Sbjct: 368 EKLEAEKEELKS--EVKCNREKAVVHVENSLAAEIEVLTSRTKELEEQLEKLEAEKVEL 424 Score = 28.3 bits (60), Expect = 1.2 Identities = 21/95 (22%), Positives = 44/95 (46%), Gaps = 5/95 (5%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ---NQ 70 + + + K+ E EV N+E A+ + SL +E+E L R++ ++E++ + + ++ Sbjct: 413 QLEKLEAEKVELESEVKC--NREEAVAQVENSLATEIEVLTCRIKQLEEKLEKLEVEKDE 470 Query: 71 ISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 + C E+ R L + + E EK Sbjct: 471 LKSEVKCNREVESTLRFELEAIACEKMELENKLEK 505 Score = 27.5 bits (58), Expect = 2.1 Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 4/70 (5%) Query: 36 ERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSH 95 E +L E+ L S ++ L E+LE ++ + + +N++ C E + L S Sbjct: 304 ENSLASEIEVLTSRIKELEEKLEKLEAEKHELENEVK----CNREEAVVHIENSEVLTSR 359 Query: 96 LSDFERLFEK 105 + E EK Sbjct: 360 TKELEEKLEK 369 >At1g24460.1 68414.m03081 myosin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II) (SP:Q99323) {Drosophila melanogaster} similar to EST gb|T76116 Length = 1730 Score = 33.1 bits (72), Expect = 0.043 Identities = 18/65 (27%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 45 SLKSEVEYLRERLEDMKEQISQTQNQISMIEI---CRISEEAKSRAHLSNLNSHLSDFER 101 SL+S + +LRE K++++ QN+I + + + E++ R L +L+ L E Sbjct: 530 SLESRLAWLRESFLQGKDEVNALQNRIESVSMSLSAEMEEKSNIRKELDDLSFSLKKMEE 589 Query: 102 LFEKG 106 E+G Sbjct: 590 TAERG 594 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/47 (29%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE--ICRISEEAKS 85 EE+ +KSEV+ L +L + + + ++ +S E I R++EE ++ Sbjct: 857 EEIEKVKSEVDALTSKLAETQTALKLVEDALSTAEDNISRLTEENRN 903 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 I K K +++ R K + L+E KSE+E L L+ + + +NQI M+ Sbjct: 730 IKKGKGLVQDREKFKTQLDEK---KSEIEKLMLELQQLGGTVDGYKNQIDML 778 >At5g52410.2 68418.m06502 expressed protein Length = 761 Score = 32.7 bits (71), Expect = 0.056 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 20 KRKIMKEKEVL-KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + I E E L ++RN+ L+ L S K+E+ Y +ER + +++Q+ +I ++ Sbjct: 526 RTSIETEMEALARIRNELEEQLQSLASNKAEMSYEKERFDRLQKQVEDENQEILRLQ 582 >At5g52410.1 68418.m06503 expressed protein Length = 510 Score = 32.7 bits (71), Expect = 0.056 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 20 KRKIMKEKEVL-KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + I E E L ++RN+ L+ L S K+E+ Y +ER + +++Q+ +I ++ Sbjct: 275 RTSIETEMEALARIRNELEEQLQSLASNKAEMSYEKERFDRLQKQVEDENQEILRLQ 331 >At5g36780.1 68418.m04406 hypothetical protein Length = 576 Score = 32.7 bits (71), Expect = 0.056 Identities = 16/54 (29%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEI 76 I+ EKE R K AL EL +K+E++ + ++ D+ +++ ++QN I ++++ Sbjct: 202 ILSEKEASINRVKSMAL--ELNEVKNELDAITWKINDLSDKLWKSQNNIRVLDL 253 >At5g36690.1 68418.m04391 hypothetical protein Length = 576 Score = 32.7 bits (71), Expect = 0.056 Identities = 16/54 (29%), Positives = 34/54 (62%), Gaps = 2/54 (3%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEI 76 I+ EKE R K AL EL +K+E++ + ++ D+ +++ ++QN I ++++ Sbjct: 202 ILSEKEASINRVKSMAL--ELNEVKNELDAITWKINDLSDKLWKSQNNIRVLDL 253 >At4g14840.1 68417.m02281 expressed protein Length = 555 Score = 32.7 bits (71), Expect = 0.056 Identities = 18/66 (27%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Query: 24 MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 + + +V L+ + L ++LG++++EV+ E + + EQI+Q Q + + + C IS + Sbjct: 437 LNKAKVASLKYEYSDLKDKLGNIQTEVDRNSETIRQIDEQIAQLQAKRTELTRC-ISNKG 495 Query: 84 KSRAHL 89 K + L Sbjct: 496 KEKVDL 501 >At2g33240.1 68415.m04072 myosin, putative similar to myosin (GI:433663) [Arabidopsis thaliana]; myosin my5A (SP:Q02440) {Gallus gallus} Length = 1770 Score = 32.7 bits (71), Expect = 0.056 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query: 20 KRKIMKE-KEVLKLRNKERALLEELGSLKS-EVEYLRERLEDMKEQISQTQ 68 K K+ KE +E+ E+ + EL +K+ EVE LR L DMK Q+ +TQ Sbjct: 907 KTKLEKEVEELTSCLELEKQMRMELEQVKTQEVEDLRSALNDMKLQLGETQ 957 Score = 25.4 bits (53), Expect = 8.6 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 18 VNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEY---LRERLEDMKEQISQTQNQI 71 + + ++ K +E+LKL++ + + E L E+E L E +K+ +S Q +I Sbjct: 953 LGETQVTKSEEILKLQSALQDMQLEFEELAKELEMTNDLAAENEQLKDLVSSLQRKI 1009 >At2g31900.1 68415.m03897 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF01843 DIL domain, PF00612 IQ calmodulin-binding motif, PF02736 myosin N-terminal SH3-like domain Length = 1556 Score = 32.7 bits (71), Expect = 0.056 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRIS 80 R + KE+ LR R E G+LK + L +R+E++ ++ +NQ + +E + Sbjct: 865 RAKVARKELKNLRMAAR----ETGALKEAKDKLEKRVEELTWRLELEKNQKADLEDAKAQ 920 Query: 81 EEAKSRAHLSNLNSHLSD 98 E AK + +L+ L L + Sbjct: 921 EIAKLQNNLTELQEKLDE 938 >At1g69460.1 68414.m07981 emp24/gp25L/p24 family protein similar to SP|Q28735 Transmembrane protein Tmp21 precursor (21 kDa Transmembrane trafficking protein) {Oryctolagus cuniculus}; contains Pfam profile: PF01105: emp24/gp25L/p24 family Length = 214 Score = 32.7 bits (71), Expect = 0.056 Identities = 15/65 (23%), Positives = 37/65 (56%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 K +S + + K+ +V + + ++LL+ + S+ E+ YLR+R E+M++ T ++ Sbjct: 123 KTGVQSKSWANVAKKSQVEVMEFEVKSLLDTVNSIHEEMYYLRDREEEMQDLNRSTNTKM 182 Query: 72 SMIEI 76 + + + Sbjct: 183 AWLSV 187 >At4g15790.1 68417.m02403 expressed protein Length = 191 Score = 32.3 bits (70), Expect = 0.074 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Query: 31 KLRNKERALLEELGSLKS----EVEYLRERLEDMKEQISQTQNQIS 72 KL + + EEL LK EVE LRE +D+K ++Q Q+ +S Sbjct: 106 KLDTQVKVYREELSGLKKTLNLEVEQLREEFKDLKTTLNQQQDDVS 151 >At5g23890.1 68418.m02806 expressed protein weak similarity to SP|P12957 Caldesmon (CDM) {Gallus gallus} Length = 946 Score = 31.9 bits (69), Expect = 0.098 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 23 IMKEKEVL-KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + E EVL +LR LE+L S K+E+ + +ER+ +++++ + +IS ++ Sbjct: 717 VESEMEVLSRLRRDAEEKLEDLMSNKAEITFEKERVFNLRKEAEEESQRISKLQ 770 Score = 26.2 bits (55), Expect = 4.9 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLED----MKEQISQTQNQISMIEICRISE 81 EKE+ R K A+ + K E+E LRE+ E+ + ++ + ++++ ++ R Sbjct: 672 EKELSMEREKIEAVEKMAELAKVELEQLREKREEENLALVKERAAVESEMEVLSRLRRDA 731 Query: 82 EAKSRAHLSNLNSHLSDFERLF 103 E K +SN + ER+F Sbjct: 732 EEKLEDLMSNKAEITFEKERVF 753 >At5g12150.1 68418.m01426 pleckstrin homology (PH) domain-containing protein / RhoGAP domain-containing protein weak similarity to glucocorticoid receptor DNA binding factor 1 [Canis familiaris] GI:23266717; contains Pfam profiles PF00169: PH domain, PF00620: RhoGAP domain Length = 827 Score = 31.9 bits (69), Expect = 0.098 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 4/71 (5%) Query: 34 NKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLN 93 +K RA LEE+ +++V L++++ ++ Q+SQ + + + + L N N Sbjct: 647 SKTRAELEEIALAEADVARLKQKVAELHHQLSQQRQH----HLSSLPDAQSHHQFLHNHN 702 Query: 94 SHLSDFERLFE 104 + L F++ F+ Sbjct: 703 TQLKSFQQDFD 713 >At2g30880.2 68415.m03764 pleckstrin homology (PH) domain-containing protein contains Pfam profile PF00169: PH domain Length = 381 Score = 31.9 bits (69), Expect = 0.098 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 + KLK K + ++ KE +L + A L+E +SE+ RER+ ++ + + + Sbjct: 278 EATKLKLKELEEKTFTLSKEKDQLVKERDAALQEAHMWRSELGKARERVVILEGAVVRAE 337 Query: 69 NQISMIEICRISEEAKSR 86 ++ + E S EAKS+ Sbjct: 338 EKVRVAE---ASGEAKSK 352 >At2g30880.1 68415.m03763 pleckstrin homology (PH) domain-containing protein contains Pfam profile PF00169: PH domain Length = 504 Score = 31.9 bits (69), Expect = 0.098 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 + KLK K + ++ KE +L + A L+E +SE+ RER+ ++ + + + Sbjct: 278 EATKLKLKELEEKTFTLSKEKDQLVKERDAALQEAHMWRSELGKARERVVILEGAVVRAE 337 Query: 69 NQISMIEICRISEEAKSR 86 ++ + E S EAKS+ Sbjct: 338 EKVRVAE---ASGEAKSK 352 >At1g80610.1 68414.m09459 expressed protein Length = 211 Score = 31.9 bits (69), Expect = 0.098 Identities = 20/81 (24%), Positives = 43/81 (53%), Gaps = 3/81 (3%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ---ISQTQNQISMIEIC 77 ++ K+K + +L+ +E LL+E LK+E+ +R+ LE + + + + + + C Sbjct: 123 KRSRKKKTLAELKEEEIMLLKESNGLKNELANMRDLLEQQRARNTALKKMKAESQSALSC 182 Query: 78 RISEEAKSRAHLSNLNSHLSD 98 +++ E S L +LN L + Sbjct: 183 KLTFEQGSSFLLPDLNMPLDN 203 >At5g38150.1 68418.m04598 expressed protein Length = 574 Score = 31.5 bits (68), Expect = 0.13 Identities = 19/50 (38%), Positives = 27/50 (54%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRE 55 E++ VKL SV ++ E++V +LR K L L SLK E+E E Sbjct: 105 EEVSRVKLDVSSVLIERVAAEEKVEELRFKTEGGLRLLESLKKEIEVANE 154 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 31.5 bits (68), Expect = 0.13 Identities = 18/90 (20%), Positives = 49/90 (54%), Gaps = 3/90 (3%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEIC---RI 79 +M ++ V K ++ L+ + GSL+ +ER++ ++++++ + ++ M+++ + Sbjct: 325 LMYKESVGKSSHELDILIAKSGSLEETCSLQKERIKMLEQELAFAKEKLKMVDLSMSHTM 384 Query: 80 SEEAKSRAHLSNLNSHLSDFERLFEKGFIL 109 +E + + + L L+D ER +G +L Sbjct: 385 TEFEEQKQCMHELQDRLADTERQLFEGELL 414 >At3g05130.1 68416.m00557 expressed protein ; expression supported by MPSS Length = 634 Score = 31.5 bits (68), Expect = 0.13 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 4/89 (4%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 +S+ + EKE+++LR AL EL S + + L+ +SQ +N+ + Sbjct: 498 ESLKSENVKLEKELVELRKAMEALKTELESAGMDAKRSMVMLKSAASMLSQLENREDRL- 556 Query: 76 ICRISEEAKSRAHLSNLNSHLSDFERLFE 104 ISEE K L E+ F+ Sbjct: 557 ---ISEEQKREIGTEPYAMELESIEKAFK 582 >At2g03290.1 68415.m00284 emp24/gp25L/p24 family protein similar to SP|P49755 Transmembrane protein Tmp21 precursor (21 kDa Transmembrane trafficking protein) {Homo sapiens}; contains Pfam profile PF01105: emp24/gp25L/p24 family Length = 170 Score = 31.5 bits (68), Expect = 0.13 Identities = 14/52 (26%), Positives = 32/52 (61%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 + K+ +V + + + L++ + S+ E+ YLRER E+M+E T ++++ + Sbjct: 90 VAKKSQVDMMEYQVKTLMDTVISIHEEMYYLREREEEMQELNRSTNSKMAWL 141 >At4g31570.1 68417.m04483 expressed protein Length = 2712 Score = 31.1 bits (67), Expect = 0.17 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Query: 22 KIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRIS- 80 KI +E L + L EEL + K+ V +MKE +S Q +M E I Sbjct: 616 KIHLVEEKYSLLGEAEKLQEELANCKTVVTLQEVENSNMKETLSLLTRQQTMFEENNIHL 675 Query: 81 EEAKSRAHLSNLNSHL 96 E +AHL L++HL Sbjct: 676 REENEKAHL-ELSAHL 690 >At4g17220.1 68417.m02590 expressed protein Length = 513 Score = 31.1 bits (67), Expect = 0.17 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEV-EYLRERLEDMKEQISQTQNQISMIEICRIS-EE 82 KEKE+L + + AL LK V + LRE + ++E++ T+NQ+ E+ R EE Sbjct: 22 KEKELLAAKAEVEALRTN-EELKDRVFKELRENVRKLEEKLGATENQVDQKELERKKLEE 80 Query: 83 AKSRA 87 K A Sbjct: 81 EKEDA 85 >At4g09950.1 68417.m01628 avirulence-responsive family protein / avirulence induced gene (AIG1) family protein similar to AIG1 protein SP:P54120 [Arabidopsis thaliana]; contains Pfam PF04548: AIG1 family; Length = 336 Score = 31.1 bits (67), Expect = 0.17 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKE--RALLEELGSLKSEVE-YLRERLEDMKEQISQT 67 +K K K + + K K+ + KE ++ E L +K ++ L+E LED+KEQ+++ Sbjct: 227 IKEKQKQIEEMKGWSSKQEISQMKKELEKSHNEMLEGIKEKISNQLKESLEDVKEQLAKA 286 Query: 68 Q 68 Q Sbjct: 287 Q 287 >At3g52490.1 68416.m05772 heat shock protein-related contains similarity to 101 kDa heat shock protein; HSP101 [Triticum aestivum] gi|11561808|gb|AAC83689 Length = 815 Score = 31.1 bits (67), Expect = 0.17 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Query: 45 SLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLS 97 SL SE E ++ E++ Q+ Q+ +Q+S E C + E+++R L + NS+++ Sbjct: 375 SLVSESELEVKKSENVSLQLQQSSDQLSFCEECSVKFESEAR-FLKSSNSNVT 426 >At3g22520.1 68416.m02846 expressed protein Length = 600 Score = 31.1 bits (67), Expect = 0.17 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Query: 24 MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 + + +V L+ + L E+LGS++ EV+ E + + +QI+Q Q + S ++ I + Sbjct: 482 LNKAKVASLKYEYSDLKEKLGSIQMEVDTNSETIRQIDDQIAQLQARRSELK-RYIGTKE 540 Query: 84 KSRAHLS 90 K R LS Sbjct: 541 KERVDLS 547 >At2g34270.1 68415.m04193 hypothetical protein and genscan Length = 374 Score = 31.1 bits (67), Expect = 0.17 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 3/66 (4%) Query: 26 EKEVLKLRN--KERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRI-SEE 82 EKEV+KL K LLE LG+ S + L E+ +E+I + + + EI +I + Sbjct: 72 EKEVIKLMKLMKLMNLLEPLGNRVSRLMGLVRNAEEHRERIVKRNQESDVREIFKIAASR 131 Query: 83 AKSRAH 88 K+R H Sbjct: 132 TKTRFH 137 >At1g05320.1 68414.m00539 myosin-related similar to non-muscle myosin II heavy chain (GI:19879404) [Loligo pealei]; ESTs gb|AA042402,gb|ATTS1380 come from this gene Length = 828 Score = 31.1 bits (67), Expect = 0.17 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 1/95 (1%) Query: 12 KLK-FKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 KLK +++ + E + KER L E L ++ +++ ERLE +I + + Sbjct: 259 KLKDLEAIQVKNSSLEATLSVAMEKERDLSENLNAVMEKLKSSEERLEKQAREIDEATTR 318 Query: 71 ISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 +E E K + + + +S ++ + L EK Sbjct: 319 SIELEALHKHSELKVQKTMEDFSSRDTEAKSLTEK 353 Score = 27.1 bits (57), Expect = 2.8 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 8/91 (8%) Query: 14 KFKSVNKRKIMKEKEVLKLRN----KERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 K + + K+ + +E LK+ + K ALL + S S +E + LE++ E++S+ ++ Sbjct: 115 KLEELQKQSASELEEKLKISDERYSKTDALLSQALSQNSVLEQKLKSLEELSEKVSELKS 174 Query: 70 QISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 + + E E KS + +S E Sbjct: 175 ALIVAE----EEGKKSSIQMQEYQEKVSKLE 201 >At5g62410.1 68418.m07832 SMC2-like condensin, putative (SMC2) (TITAN3) very strong similarity to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1175 Score = 30.7 bits (66), Expect = 0.23 Identities = 27/105 (25%), Positives = 56/105 (53%), Gaps = 8/105 (7%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALL--EELGSLKSEVEYLRERLEDMKEQISQ 66 +L +LK K + K +KE++ + E A+ ELG+ K++VE++++ LE + Q Sbjct: 413 ELKQLKTKIEHCEKELKERKSQLMSKLEEAIEVENELGARKNDVEHVKKALESIPYNEGQ 472 Query: 67 TQ----NQISMIEIC-RISEEAKS-RAHLSNLNSHLSDFERLFEK 105 + ++ + +E+ R+ ++ + A L+N SD R F++ Sbjct: 473 MEALEKDRGAELEVVQRLEDKVRGLSAQLANFQFTYSDPVRNFDR 517 Score = 26.6 bits (56), Expect = 3.7 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%) Query: 27 KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 +E KL NKE LL E K VE + +ED+K+ + + Sbjct: 312 RESSKLNNKEDTLLGE----KENVEKIVHSIEDLKKSVKE 347 >At5g07890.1 68418.m00910 myosin heavy chain-related contains weak similarity to Myosin heavy chain, cardiac muscle alpha isoform (MyHC-alpha) (Alpha isomyosin) (Fragment) (Swiss-Prot:P04460) [Oryctolagus cuniculus] Length = 409 Score = 30.7 bits (66), Expect = 0.23 Identities = 15/46 (32%), Positives = 27/46 (58%) Query: 24 MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 M EKE+L + L ++L EV YL E L D++ ++++++N Sbjct: 82 MMEKELLNCYKEIDYLRDQLIFRSKEVNYLNEHLHDLEFKLAESRN 127 Score = 26.2 bits (55), Expect = 4.9 Identities = 16/69 (23%), Positives = 38/69 (55%), Gaps = 6/69 (8%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELG----SLKSEVEYLRERLEDMKE 62 KLD+ L+ + KI +E ++ +++ + ++EE K V+Y+ ++ ED++E Sbjct: 189 KLDITALEQALFDAMKIQEES--IQEKDQLKGIIEESQFQSQRAKENVKYIEKQNEDLRE 246 Query: 63 QISQTQNQI 71 + + ++ I Sbjct: 247 KFTASEKSI 255 >At1g63300.1 68414.m07156 expressed protein similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum] Length = 1029 Score = 30.7 bits (66), Expect = 0.23 Identities = 21/97 (21%), Positives = 47/97 (48%), Gaps = 6/97 (6%) Query: 6 EKLDLV-KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 +K++L K+ + E +V+KL E+ L L++E+E +R + +D+K + Sbjct: 781 KKIELESKISLMRKESESLAAELQVIKLAKDEKETAISL--LQTELETVRSQCDDLKHSL 838 Query: 65 SQTQNQIS--MIEICRISEEAKSRAH-LSNLNSHLSD 98 S+ ++ ++ + E K + ++NL L + Sbjct: 839 SENDLEMEKHKKQVAHVKSELKKKEETMANLEKKLKE 875 Score = 27.5 bits (58), Expect = 2.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Query: 27 KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMK 61 K+++K + + LL E+ SLK E + L+E E K Sbjct: 316 KQIVKETKRSQDLLREVNSLKQERDSLKEDCERQK 350 Score = 27.5 bits (58), Expect = 2.1 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 E++G L +E+E LRE M+ ++ + + + S I + R +E R L + +L + + Sbjct: 969 EDIGVLVAEIESLRECNGSMEMELKEMRERYSEISL-RFAEVEGERQQLVMIVRNLKNAK 1027 Query: 101 R 101 R Sbjct: 1028 R 1028 Score = 25.8 bits (54), Expect = 6.5 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Query: 27 KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE--ICRISEEAK 84 +E LK++ + + L ++ L+++VE L L+ E+ S++ +I +E + + EE + Sbjct: 519 QEQLKIQYECSSSLVDVTELENQVESLEAELKKQSEEFSESLCRIKELESQMETLEEEME 578 Query: 85 SRAHL 89 +A + Sbjct: 579 KQAQV 583 >At5g66310.1 68418.m08360 kinesin motor family protein contains Pfam domain, PF00225: Kinesin motor domain Length = 1063 Score = 30.3 bits (65), Expect = 0.30 Identities = 15/43 (34%), Positives = 26/43 (60%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 K+ EV KL+ + L ++L +SE++ LR +E+ K Q +T Sbjct: 391 KDLEVEKLKKEVFQLAQQLEQARSEIKDLRRMVEEEKNQEKET 433 >At5g58000.1 68418.m07256 phosphatase-related weak similarity to CTD phosphatase-like 3 [Arabidopsis thaliana] GI:22212705; contains Pfam profiles PF02453: Reticulon, PF00533: BRCA1 C Terminus (BRCT) domain, PF03031: NLI interacting factor Length = 1011 Score = 30.3 bits (65), Expect = 0.30 Identities = 11/38 (28%), Positives = 23/38 (60%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLE 41 CG+KL+ + F+ ++K + E E+ +LR+ + L+ Sbjct: 652 CGQKLEETGVSFRYIHKEMRLNEDEISRLRDSDSRFLQ 689 >At5g27330.1 68418.m03263 expressed protein Length = 628 Score = 30.3 bits (65), Expect = 0.30 Identities = 21/71 (29%), Positives = 43/71 (60%), Gaps = 4/71 (5%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYL---RERLEDM 60 C E+ DLVK F ++ + ++ V++L +E +L EE+G LK E L R++ E++ Sbjct: 171 CDER-DLVKSGFDLQSEEMNLLKESVVRLEMREVSLGEEVGRLKCENGRLVKERKKREEV 229 Query: 61 KEQISQTQNQI 71 E+ ++ ++++ Sbjct: 230 IERGNRERSEL 240 >At5g23700.1 68418.m02778 hypothetical protein Length = 572 Score = 30.3 bits (65), Expect = 0.30 Identities = 18/73 (24%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKER-ALLEELGSLKSEVEYLRERLEDMKEQ 63 GE + L + K S + + + + LK N+++ EE+ SL+SE++ L++ E E Sbjct: 234 GEGVSL-EAKLLSRKEAALRQREAALKAANEKKDGKKEEVVSLRSEIQILKDEAETAAEC 292 Query: 64 ISQTQNQISMIEI 76 + + +++ + I Sbjct: 293 LQEAESEAKALRI 305 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 30.3 bits (65), Expect = 0.30 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 4/93 (4%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 E L++ + + SV + EKEV KL+++ + EE + + R++ + E+ S Sbjct: 387 EDLEVSEQRLGSVEEEVSKNEKEVEKLKSELETVKEEKNRALKKEQDATSRVQRLSEEKS 446 Query: 66 QTQNQISMIEICRISEEAKSRAHLSNLNSHLSD 98 + +S +E + EE KS+ + +L S L + Sbjct: 447 KL---LSDLESSK-EEEEKSKKAMESLASALHE 475 Score = 29.1 bits (62), Expect = 0.69 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 11/105 (10%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSL-------KSEVEYLRERLE 58 +KL + + + +R + E V K + + LGS+ + EVE L+ LE Sbjct: 359 DKLHDTETEITDLKERIVTLETTVAKQKEDLEVSEQRLGSVEEEVSKNEKEVEKLKSELE 418 Query: 59 DMKEQISQT--QNQISMIEICRISEEAKSRAHLSNLNSHLSDFER 101 +KE+ ++ + Q + + R+SEE KS+ LS+L S + E+ Sbjct: 419 TVKEEKNRALKKEQDATSRVQRLSEE-KSKL-LSDLESSKEEEEK 461 >At5g11140.1 68418.m01302 hypothetical protein Length = 241 Score = 30.3 bits (65), Expect = 0.30 Identities = 19/64 (29%), Positives = 34/64 (53%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 +L L K + + K+ KEKE+ + R K +LGSL+ + L +RL ++ ++ + Sbjct: 171 RLLLAKQEMELSLKKLAEKEKEMKEFREKLMKTTGKLGSLEMKRTCLDKRLVFLRSKVEK 230 Query: 67 TQNQ 70 Q Q Sbjct: 231 FQGQ 234 >At4g02800.1 68417.m00380 expressed protein similar to A. thaliana hypothetical protein T6B20.12 (1946366) Length = 333 Score = 30.3 bits (65), Expect = 0.30 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Query: 16 KSVNKRKIMKEKE--VLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 K +RKIMK+ + + + K +L EL ++KS++ +++ER ++E+ Sbjct: 170 KRPKERKIMKKAKNIAISMAAKANSLARELKTIKSDLSFIQERCGLLEEE 219 >At3g12020.1 68416.m01490 kinesin motor protein-related similar to putative kinesin heavy chain GB:AAD23684 GI:4567271 from [Arabidopsis thaliana] Length = 1030 Score = 30.3 bits (65), Expect = 0.30 Identities = 23/98 (23%), Positives = 49/98 (50%), Gaps = 6/98 (6%) Query: 13 LKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQIS 72 +K++ ++ I+ K ++K + R + + L E E L+E + ++K+Q+S+ Sbjct: 781 IKYQYSKRQTILTMKLMVKAADN-RIIQQTLNEKTCECEVLQEEVANLKQQLSEALELAQ 839 Query: 73 MIEICRISEEAK----SRAHLSNLNSHLSDFERLFEKG 106 +I + ++AK S+ L N L++ E + KG Sbjct: 840 GTKIKELKQDAKELSESKEQLELRNRKLAE-ESSYAKG 876 Score = 28.3 bits (60), Expect = 1.2 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 K+K + +++ + KE L+LRN R L EE K L+ + E++++ NQ Sbjct: 842 KIKELKQDAKELSESKEQLELRN--RKLAEESSYAKGLASAAAVELKALSEEVAKLMNQ 898 >At2g38720.1 68415.m04755 microtubule associated protein (MAP65/ASE1) family protein low similarity to myosin [Schistosoma japonicum] GI:3941320; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 587 Score = 30.3 bits (65), Expect = 0.30 Identities = 14/42 (33%), Positives = 28/42 (66%) Query: 33 RNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 + KE +L E++ S+K +E L + + ++++S+T NQI+ I Sbjct: 85 KKKEGSLKEQISSVKPVLEDLLMKKDRRRKELSETLNQIAEI 126 >At2g31820.1 68415.m03886 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 662 Score = 30.3 bits (65), Expect = 0.30 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Query: 22 KIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISE 81 KI + V L+ A ++LG ++ + L++ + D+K ++ Q+Q Q S R+ + Sbjct: 403 KIGNAELVSVLKEAGAATAKDLGKPQNPAKQLKQTVSDIKHEV-QSQLQQSRQTGVRVQK 461 Query: 82 EAK--SRAHLSNLNSHLS 97 AK + H+S LN+ ++ Sbjct: 462 IAKRLKKLHISGLNNAIN 479 >At2g30500.1 68415.m03715 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 517 Score = 30.3 bits (65), Expect = 0.30 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Query: 18 VNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEIC 77 +NK K KEVLKL+ + + L +E+ L+ + D +++I + QI Sbjct: 318 INKLNAEK-KEVLKLQERLAMVKTSLQDRDNEIRALKTAVSDAEQKIFPEKAQIKGEMSK 376 Query: 78 RISEEAKSRAHLSNLNSHL 96 + E ++ L L SH+ Sbjct: 377 MLEERSQLGEQLRELESHI 395 Score = 26.2 bits (55), Expect = 4.9 Identities = 18/87 (20%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKER-ALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 +L+ + K+ + L+L ++ + +L + K EV L+ERL +K + N+ Sbjct: 289 ELEIGKAAEEKLKSLQHELELAQRDADTYINKLNAEKKEVLKLQERLAMVKTSLQDRDNE 348 Query: 71 ISMIEICRISEEAKSRAHLSNLNSHLS 97 I ++ E K + + +S Sbjct: 349 IRALKTAVSDAEQKIFPEKAQIKGEMS 375 >At1g63640.2 68414.m07198 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1065 Score = 30.3 bits (65), Expect = 0.30 Identities = 13/52 (25%), Positives = 33/52 (63%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED 59 ++ +KL+ + +++ +EK+V++LR ++ E+ LK E++ ++E E+ Sbjct: 293 MEHIKLEKTRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHEN 344 >At1g63640.1 68414.m07197 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1064 Score = 30.3 bits (65), Expect = 0.30 Identities = 13/52 (25%), Positives = 33/52 (63%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED 59 ++ +KL+ + +++ +EK+V++LR ++ E+ LK E++ ++E E+ Sbjct: 293 MEHIKLEKTRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHEN 344 >At1g13650.2 68414.m01605 expressed protein Length = 286 Score = 30.3 bits (65), Expect = 0.30 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 4/87 (4%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLR----ERLEDMKE 62 K + +L+ +RK+ K+K KE+A +L +K+E LR E + KE Sbjct: 182 KAEETQLRMVIAEERKVRKDKAEKTQLRKEKAEESQLREVKAEETQLRMVKAEETQLRKE 241 Query: 63 QISQTQNQISMIEICRISEEAKSRAHL 89 + +TQ ++ + E ++ +E + L Sbjct: 242 KAEETQLRMVIAEERQLRKEKDEKRQL 268 >At1g13650.1 68414.m01604 expressed protein Length = 281 Score = 30.3 bits (65), Expect = 0.30 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 4/87 (4%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLR----ERLEDMKE 62 K + +L+ +RK+ K+K KE+A +L +K+E LR E + KE Sbjct: 177 KAEETQLRMVIAEERKVRKDKAEKTQLRKEKAEESQLREVKAEETQLRMVKAEETQLRKE 236 Query: 63 QISQTQNQISMIEICRISEEAKSRAHL 89 + +TQ ++ + E ++ +E + L Sbjct: 237 KAEETQLRMVIAEERQLRKEKDEKRQL 263 >At1g06170.2 68414.m00649 basic helix-loop-helix (bHLH) family protein contains Pfam profile:PF00010 helix-loop-helix DNA-binding domain Length = 420 Score = 30.3 bits (65), Expect = 0.30 Identities = 16/50 (32%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Query: 2 SCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKE-RALLEELGSLKSEV 50 S GE +D +K +++++ K++ EK+ +K RN+E +++E +SEV Sbjct: 249 SIVGEAIDYIKELLRTIDEFKLLVEKKRVKQRNREGDDVVDENFKAQSEV 298 >At1g06170.1 68414.m00648 basic helix-loop-helix (bHLH) family protein contains Pfam profile:PF00010 helix-loop-helix DNA-binding domain Length = 420 Score = 30.3 bits (65), Expect = 0.30 Identities = 16/50 (32%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Query: 2 SCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKE-RALLEELGSLKSEV 50 S GE +D +K +++++ K++ EK+ +K RN+E +++E +SEV Sbjct: 249 SIVGEAIDYIKELLRTIDEFKLLVEKKRVKQRNREGDDVVDENFKAQSEV 298 >At5g41780.1 68418.m05087 myosin heavy chain-related weak similarity to M protein, serotype 5 precursor (SP:P02977) {Streptococcus pyogenes} and to Myosin heavy chain, non-muscle (SP:Q99323) (Zipper protein) (Myosin II) {Drosophila melanogaster} Length = 537 Score = 29.9 bits (64), Expect = 0.40 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 2/71 (2%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 E+ ++K EVE L +LE + Q S + ++S +E +++EE + LS + E Sbjct: 430 EKDNNMKHEVETLEAKLECREAQESLLKEKLSKLE-AKLAEEGTEKLSLSKAMRKIKKLE 488 Query: 101 -RLFEKGFILI 110 + EK F L+ Sbjct: 489 INVKEKEFELL 499 >At4g11100.1 68417.m01802 expressed protein Length = 287 Score = 29.9 bits (64), Expect = 0.40 Identities = 24/93 (25%), Positives = 50/93 (53%), Gaps = 4/93 (4%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 +D +K K + + K +E+E++K+ NK L E+ ++ E YL+ L D + S T Sbjct: 95 VDELKSKNQELLLGKKKEEEELVKMENKYVELAEKFDVVEKECAYLKS-LYDAEVVASVT 153 Query: 68 QNQI--SMIEICRISEEAKSRAHLSNLNSHLSD 98 Q+ + + E + + ++ A+ N+N+ ++D Sbjct: 154 QSAVISGVGETDNLIGQGENEAN-QNVNNAVTD 185 >At2g46180.1 68415.m05742 intracellular protein transport protein USO1-related similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 725 Score = 29.9 bits (64), Expect = 0.40 Identities = 21/96 (21%), Positives = 46/96 (47%), Gaps = 3/96 (3%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 D + + K + + + KE E + +++ L++EL + EY R ++ +++ + QT Sbjct: 368 DKARQELKRLKQHLLEKETEESEKMDEDSRLIDEL---RQTNEYQRSQILGLEKALRQTM 424 Query: 69 NQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFE 104 I+ E KS+ + +LN L++ R + Sbjct: 425 ANQEEIKSSSDLEIRKSKGIIEDLNQKLANCLRTID 460 Score = 26.2 bits (55), Expect = 4.9 Identities = 19/89 (21%), Positives = 49/89 (55%), Gaps = 6/89 (6%) Query: 12 KLKFKSVNKRKIMKEKE-VLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 +++ K +R++ KE +KL + + + E+L S K E E + ++ + ++ +N+ Sbjct: 479 EIEAKEHFERELAVAKEDAMKLSARLKDVDEQLESSKKEKEEITSKVLHAENIAAEWKNR 538 Query: 71 ISMIE-----ICRISEEAKSRAHLSNLNS 94 +S +E + R+ E++ +R + +++S Sbjct: 539 VSKVEDDNAKVRRVLEQSMTRLNRMSMDS 567 >At2g34730.1 68415.m04265 myosin heavy chain-related low similarity to SP|P14105 Myosin heavy chain, nonmuscle (Cellular myosin heavy chain) {Gallus gallus} Length = 825 Score = 29.9 bits (64), Expect = 0.40 Identities = 14/50 (28%), Positives = 32/50 (64%), Gaps = 4/50 (8%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQIS 72 ++ +E+ K++ E ++ SL+ E+E RE L++MK++ +T+ ++S Sbjct: 638 VVSARELEKVKGYET----KISSLREELELARESLKEMKDEKRKTEEKLS 683 >At1g79830.1 68414.m09326 expressed protein weak similarity to TATA element modulatory factor (TMF) (Swiss-Prot:P82094) [Homo sapiens] Length = 927 Score = 29.9 bits (64), Expect = 0.40 Identities = 15/44 (34%), Positives = 23/44 (52%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 E+ LR + A LE +G E+E LR + D+KE + N + Sbjct: 879 ELEALRQRHAAALELMGERDEELEELRADIVDLKEMYREQVNML 922 >At1g65010.1 68414.m07368 expressed protein similar to endosome-associated protein (GI:1016368) [Homo sapiens]; similar to Centromeric protein E (CENP-E protein) (Swiss-Prot:Q02224) [Homo sapiens] Length = 1318 Score = 29.9 bits (64), Expect = 0.40 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 E + LKSE+E LR LE + S + Q ++E ++ EA A S NS + +++ Sbjct: 228 EIVSKLKSEIELLRGELEKVSILESSLKEQEGLVEQLKVDLEAAKMAE-SCTNSSVEEWK 286 Score = 26.2 bits (55), Expect = 4.9 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 27 KEVLKLRNKERALLEE-LGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 K LK+ E L+E LG K+E L+E L D +E + +IS + Sbjct: 560 KNNLKVAEGEVKYLQETLGEAKAESMKLKESLLDKEEDLKNVTAEISSL 608 >At1g64330.1 68414.m07290 myosin heavy chain-related similar to myosin heavy chain (GI:1850913) [Entamoeba histolytica]; similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 555 Score = 29.9 bits (64), Expect = 0.40 Identities = 19/83 (22%), Positives = 35/83 (42%) Query: 1 MSCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDM 60 + GE + K + V K + E E+ + LEE+ L+ + LE Sbjct: 190 LEVAGETESDLNQKLEDVKKERDGLEAELASKAKDHESTLEEVNRLQGQKNETEAELERE 249 Query: 61 KEQISQTQNQISMIEICRISEEA 83 K++ NQI+ ++ + +EA Sbjct: 250 KQEKPALLNQINDVQKALLEQEA 272 Score = 27.1 bits (57), Expect = 2.8 Identities = 24/104 (23%), Positives = 49/104 (47%), Gaps = 4/104 (3%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 E L+ K + +R K+V + L E + SL++EVE + +E + E++S Sbjct: 307 EMLEEYMSKMEETERRMQETGKDVASRESAIVDLEETVESLRNEVERKGDEIESLMEKMS 366 Query: 66 QTQNQISMI-EICRISEE--AKSRAHLSNLNS-HLSDFERLFEK 105 + ++ + + R++E+ + L + + HL + L EK Sbjct: 367 NIEVKLRLSNQKLRVTEQVLTEKEGELKRIEAKHLEEQALLEEK 410 >At1g26690.1 68414.m03251 emp24/gp25L/p24 family protein similar to SP|P49755 Transmembrane protein Tmp21 precursor (21 kDa Transmembrane trafficking protein) {Homo sapiens}; contains Pfam profile PF01105: emp24/gp25L/p24 family Length = 214 Score = 29.9 bits (64), Expect = 0.40 Identities = 14/52 (26%), Positives = 30/52 (57%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 + K+ +V + + L+E + S+ E+ YLRER E+M+ T ++++ + Sbjct: 134 VAKKSQVEVMEFDVKRLIETVNSIHEEMFYLREREEEMQNLNRATNSKMAWL 185 >At1g10320.1 68414.m01162 U2 snRNP auxiliary factor-related similar to U2 small nuclear ribonucleoprotein auxiliary factor 35 kD subunit related protein 1 (sp|Q15695) Length = 757 Score = 29.9 bits (64), Expect = 0.40 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRER-LEDMKEQISQTQNQ 70 KLK K V K KE+E K + + A E L +++ E RE+ L+D +E + Sbjct: 44 KLKRKQVRKEIAAKEREEAKAKLNDPAEQERLKAIEEEDARRREKELKDFEESERAWREA 103 Query: 71 ISMIEICRISEEAK 84 + + EEAK Sbjct: 104 MEIKRKKEEEEEAK 117 >At5g65930.2 68418.m08300 kinesin-like calmodulin-binding protein (ZWICHEL) identical to kinesin-like protein GI:2224925 from [Arabidopsis thaliana] Length = 1260 Score = 29.5 bits (63), Expect = 0.53 Identities = 29/112 (25%), Positives = 59/112 (52%), Gaps = 10/112 (8%) Query: 6 EKLDLVKLKFKSV--NKRKIMKEKEVLKLR-----NKERALLEELGSLKSEVEYLRERLE 58 + L++ K K + V ++++ +EK+VLKLR NK L ++L S +S +E + Sbjct: 765 QNLNIEKKKKEEVEIHQKRYEQEKKVLKLRVSELENKLEVLAQDLDSAESTIESKNSDML 824 Query: 59 DMKEQISQTQNQISMIE-ICRISEEAKSRAHLSNLNSHLSDFERLFEKGFIL 109 ++ + + + M E I R +E+ + A L + L++ E L+++ +L Sbjct: 825 LLQNNLKELEELREMKEDIDRKNEQ--TAAILKMQGAQLAELEILYKEEQVL 874 >At5g65930.1 68418.m08299 kinesin-like calmodulin-binding protein (ZWICHEL) identical to kinesin-like protein GI:2224925 from [Arabidopsis thaliana] Length = 1259 Score = 29.5 bits (63), Expect = 0.53 Identities = 29/112 (25%), Positives = 59/112 (52%), Gaps = 10/112 (8%) Query: 6 EKLDLVKLKFKSV--NKRKIMKEKEVLKLR-----NKERALLEELGSLKSEVEYLRERLE 58 + L++ K K + V ++++ +EK+VLKLR NK L ++L S +S +E + Sbjct: 764 QNLNIEKKKKEEVEIHQKRYEQEKKVLKLRVSELENKLEVLAQDLDSAESTIESKNSDML 823 Query: 59 DMKEQISQTQNQISMIE-ICRISEEAKSRAHLSNLNSHLSDFERLFEKGFIL 109 ++ + + + M E I R +E+ + A L + L++ E L+++ +L Sbjct: 824 LLQNNLKELEELREMKEDIDRKNEQ--TAAILKMQGAQLAELEILYKEEQVL 873 >At5g48660.1 68418.m06022 expressed protein ; expression supported by MPSS Length = 219 Score = 29.5 bits (63), Expect = 0.53 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 3/78 (3%) Query: 27 KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI--EICRISEEAK 84 ++++ LR+ + EEL L+ E L+E+ E ++I Q Q ++S I + + E+K Sbjct: 113 RKLINLRSNVGSSKEELEQLQKERTELKEKEEKASKEIKQLQVKLSSITERLKKAETESK 172 Query: 85 SR-AHLSNLNSHLSDFER 101 + L +H++ ++ Sbjct: 173 EKEKKLETAETHVTALQK 190 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/79 (20%), Positives = 43/79 (54%), Gaps = 2/79 (2%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 E+L+ ++ + + +++ KE+ +L+ K ++ E L ++E + ++LE + ++ Sbjct: 127 EELEQLQKERTELKEKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKLETAETHVT 186 Query: 66 QTQNQIS--MIEICRISEE 82 Q Q + ++E R+ E+ Sbjct: 187 ALQKQSAELLLEYDRLLED 205 Score = 26.2 bits (55), Expect = 4.9 Identities = 16/77 (20%), Positives = 37/77 (48%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 +KE +L+ KE +E+ L+ ++ + ERL+ + + + + ++ E + + +S Sbjct: 133 QKERTELKEKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKLETAETHVTALQKQS 192 Query: 86 RAHLSNLNSHLSDFERL 102 L + L D + L Sbjct: 193 AELLLEYDRLLEDNQHL 209 >At5g03060.1 68418.m00254 expressed protein ; expression supported by MPSS Length = 292 Score = 29.5 bits (63), Expect = 0.53 Identities = 21/70 (30%), Positives = 42/70 (60%), Gaps = 7/70 (10%) Query: 11 VKLKFKSVNK-RKIMK---EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 ++ FK +N+ +IMK +K++ +L K +LL++L +SE E E +++MK IS+ Sbjct: 56 IEESFKQMNEMNEIMKFQYQKQIKELEEKILSLLKDLEKERSEKE---EYMKEMKGMISE 112 Query: 67 TQNQISMIEI 76 + I+ + + Sbjct: 113 KEAIINDLSV 122 >At4g30630.1 68417.m04344 expressed protein Length = 237 Score = 29.5 bits (63), Expect = 0.53 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISE 81 EKE+ R + + ++ +LKSEV +LR R E +K Q Q + E+ R+SE Sbjct: 28 EKELEIKRKRLEMIKQKRLTLKSEVRFLRRRYEHLK----QDQTLETSPEMLRLSE 79 >At4g27260.1 68417.m03913 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 612 Score = 29.5 bits (63), Expect = 0.53 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNK-ERALLEELGSLKSEVEYLR 54 E L++ L NK+K+ +E+ ++ +R +LEE+ + ++VEYLR Sbjct: 8 ESLEVFDLTLDQKNKQKLQLIEELTSNADQVQRQVLEEILTRNADVEYLR 57 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 29.5 bits (63), Expect = 0.53 Identities = 17/60 (28%), Positives = 30/60 (50%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 G K+D ++ K + V ++KI + +++ E L EEL LK + LE K ++ Sbjct: 489 GFKVDWLERKLEEVTEKKIQEHIGKSRMQGLEEDLKEELKDLKQKCSDTEALLEKEKTKV 548 Score = 27.9 bits (59), Expect = 1.6 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 G K+D ++ K + V ++KI + +++ + L E+L K + + LE KE++ Sbjct: 251 GFKVDWLERKLEEVKEKKIQEHIG----KSRMQGLEEDLKVFKKKCSDIEALLEKEKEEL 306 Query: 65 SQTQNQISMIEICRISEEAK 84 + + S IE E+ K Sbjct: 307 KGLKQKCSDIEALLEKEKGK 326 >At2g22560.1 68415.m02674 kinase interacting protein-related similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia]; weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum Length = 891 Score = 29.5 bits (63), Expect = 0.53 Identities = 19/93 (20%), Positives = 45/93 (48%), Gaps = 4/93 (4%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 EK+D + K S+ + + +LRN+ L ++ +L+++ L + D++ ++ Sbjct: 299 EKVDELVNKVISLESAVSSQTALIQRLRNETNGLQTQISTLETDKALLADDKSDLRNKLK 358 Query: 66 QTQNQISMIEICRISEEAKSRAHLSNLNSHLSD 98 + + ++ ++ + KS SNL +H D Sbjct: 359 EMEEKLKALQDLDRNVLDKS----SNLQTHFDD 387 >At1g50660.1 68414.m05696 expressed protein similar to liver stage antigen-1 (GI:510184) [Plasmodium falciparum]; similar to Myosin II heavy chain, non muscle (Swiss-Prot:P08799) [Dictyostelium discoideum]; similar to liver stage antigen (GI:9916) [Plasmodium falciparum]; similar to Kinesin-like protein KLPA (Swiss-Prot:P28739) [Emericella nidulans] Length = 725 Score = 29.5 bits (63), Expect = 0.53 Identities = 11/40 (27%), Positives = 23/40 (57%) Query: 39 LLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICR 78 L +E+G K+E+E L+ ++E++ + + M E+ R Sbjct: 352 LAKEIGEDKAEIEALKRESMSLREEVDDERRMLQMAEVWR 391 >At5g59390.1 68418.m07442 XH/XS domain-containing protein contains Pfam domain PF03469: XH domain and PF03468: XS domain Length = 561 Score = 29.1 bits (62), Expect = 0.69 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 7/84 (8%) Query: 22 KIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISE 81 K + E E + + ERA L E ++ +E E + RLE + NQ +M E +E Sbjct: 242 KSLAELEAKREKLDERARLIEQRAIINEEEMEKSRLE-------REMNQKAMCEQNEANE 294 Query: 82 EAKSRAHLSNLNSHLSDFERLFEK 105 EA A +S L + E+L ++ Sbjct: 295 EAMKLAEKHQASSSLKEKEKLHKR 318 >At5g57910.1 68418.m07244 expressed protein similar to unknown protein (emb|CAB79781.1) Length = 207 Score = 29.1 bits (62), Expect = 0.69 Identities = 11/33 (33%), Positives = 23/33 (69%) Query: 31 KLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 K+R + +L+++ G L E E +R+RL+ ++E+ Sbjct: 20 KVRFRHHSLMQDYGELHMETEAMRKRLQAVRER 52 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 29.1 bits (62), Expect = 0.69 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLR---ERLEDMKEQISQT 67 +K K ++ N+ +++ +E+ + + EL LKSE + L+ ++L+D KEQI + Sbjct: 144 LKKKIETYNQGLVIRRQEIEQAKVGLEKDAAELKKLKSEQKILKGLVDQLKDRKEQIEKV 203 Query: 68 QNQ 70 + + Sbjct: 204 EEK 206 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 29.1 bits (62), Expect = 0.69 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 3/74 (4%) Query: 13 LKFKSVNKRKIMKEKEVLKLRNKE-RALLEELGS--LKSEVEYLRERLEDMKEQISQTQN 69 LKFK K+K +++K+ L L E A+ LG+ L S + R+ +++ KE+I + Sbjct: 390 LKFKKPKKKKQLRKKDKLDLSMLEAEAVASGLGAEDLGSRKDGRRQAMKEEKERIEYEKR 449 Query: 70 QISMIEICRISEEA 83 + E ++EA Sbjct: 450 SNAYQEAIAKADEA 463 >At5g04420.1 68418.m00435 kelch repeat-containing protein low similarity to rngB protein, Dictyostelium discoideum, PIR:S68824; contains Pfam profile PF01344: Kelch motif Length = 514 Score = 29.1 bits (62), Expect = 0.69 Identities = 15/75 (20%), Positives = 38/75 (50%), Gaps = 4/75 (5%) Query: 32 LRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSN 91 ++ ++RAL + + E LRE+++++ ++ ++ +E ISE R+ Sbjct: 405 IKEEKRALESSIAETQVENAKLREKIDEVNSSHTELSQELQSVEGQLISE----RSRCFK 460 Query: 92 LNSHLSDFERLFEKG 106 L + +++ ++ E G Sbjct: 461 LEAQIAELQKALESG 475 >At3g58840.1 68416.m06558 expressed protein Length = 318 Score = 29.1 bits (62), Expect = 0.69 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 2/67 (2%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI--EICRISEEA 83 E+++ + NK + L E LK +E L +E+MK+ ++ + + EI EE Sbjct: 26 ERKIEDMENKNQELTRENRELKERLERLTGEIEEMKDVEAEMNQRFGEMEKEIEEYEEEK 85 Query: 84 KSRAHLS 90 K+ +S Sbjct: 86 KALEAIS 92 >At2g42480.1 68415.m05255 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 743 Score = 29.1 bits (62), Expect = 0.69 Identities = 22/101 (21%), Positives = 51/101 (50%), Gaps = 7/101 (6%) Query: 1 MSCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYL---RERL 57 + C KL+ V +K K + + ++ +L+N E L +L LKS++E + ++ Sbjct: 600 LDCLKSKLEEVSIKNKKADADRSRVQRLEERLKNLE---LMDLDCLKSKLELVSIKNKKA 656 Query: 58 EDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSD 98 + + +I + + ++ +E+ + ++ KS+ +L SD Sbjct: 657 DADRSRIQRLEERVKKLELMEL-DDLKSKLEEVSLERKKSD 696 Score = 27.9 bits (59), Expect = 1.6 Identities = 17/77 (22%), Positives = 38/77 (49%), Gaps = 1/77 (1%) Query: 1 MSCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED- 59 + C KL+LV +K K + + ++ +++ E L++L S EV R++ +D Sbjct: 639 LDCLKSKLELVSIKNKKADADRSRIQRLEERVKKLELMELDDLKSKLEEVSLERKKSDDA 698 Query: 60 MKEQISQTQNQISMIEI 76 + ++ Q + +E+ Sbjct: 699 YRSRVYQLEECFKNLEL 715 >At1g59540.1 68414.m06694 kinesin motor protein-related similar to kinesin motor protein (kin2) GI:2062751 from (Ustilago maydis) Length = 823 Score = 29.1 bits (62), Expect = 0.69 Identities = 16/66 (24%), Positives = 35/66 (53%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 +KL++ +L+ K + E+E+L L N+ E LK+++E + + ++ + I Sbjct: 344 QKLEIEELRMKLQGSHAEVLEQEILNLSNQMLKYELECERLKTQLEEEKRKQKEQENCIK 403 Query: 66 QTQNQI 71 + Q +I Sbjct: 404 EQQMKI 409 Score = 27.9 bits (59), Expect = 1.6 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 6/92 (6%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI------EICRI 79 EKE+ + A E L EV++L+E + + +ISQ+ ++ +I + + Sbjct: 714 EKELCLDKQLLEASRESHEKLIKEVQFLKEERDSLDRKISQSTQRLRVIASDKENALKDL 773 Query: 80 SEEAKSRAHLSNLNSHLSDFERLFEKGFILIH 111 + E K R + H+S K F+ H Sbjct: 774 NVEVKRRKDMEEEIKHISIAFATRHKSFVSFH 805 >At1g56040.1 68414.m06434 U-box domain-containing protein contains Pfam profile PF04564: U-box domain Length = 437 Score = 29.1 bits (62), Expect = 0.69 Identities = 26/103 (25%), Positives = 45/103 (43%), Gaps = 6/103 (5%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 VKL+ K MK+++V + + EE G L+ + + L +LE +T+ Sbjct: 152 VKLR-KEAEDALAMKKEDVEMMEQLLESYKEEQGKLQLQAKALEHKLEAELRHRKETETL 210 Query: 71 ISM----IEICRISEEAKSRAHLSNLNSHLSDFERLFEKGFIL 109 +++ IE +I E + N +FER +E IL Sbjct: 211 LAIERDRIEKVKIQLETVEN-EIDNTRLKAEEFERKYEGEMIL 252 >At1g54930.1 68414.m06273 zinc knuckle (CCHC-type) family protein contains INTERPRO domain, IPR001878: Zn-finger CCHC type Length = 353 Score = 29.1 bits (62), Expect = 0.69 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 3/63 (4%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRA 87 E + +++ E AL GS K ++E LR+R +K+Q+ + + Q+ + E SE A S Sbjct: 266 ESISMKHVE-ALTAYTGSYK-QLESLRDRAHSLKKQLLEVEKQVKLCE-AETSEFAASVQ 322 Query: 88 HLS 90 +S Sbjct: 323 EVS 325 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 29.1 bits (62), Expect = 0.69 Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Query: 20 KRKIMKEKEVLKLRNKERALL-EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICR 78 K K+ +E L N ++ L E SL S ++ +R+R+ED++++ + ++ ++E+ Sbjct: 754 KSKLKSLEESCHLLNDDKTTLTSERESLLSHIDTMRKRIEDLEKE--HAELKVKVLELAT 811 Query: 79 ISEEAKSRAHLSNLNSHLSDFE 100 E + + ++ + D E Sbjct: 812 ERESSLQKIEELGVSLNAKDCE 833 Score = 27.9 bits (59), Expect = 1.6 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 13/106 (12%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEY-------LRERLE 58 E++ K + KS+N+ + + L+ + L E + L++EVE L++ + Sbjct: 542 EEVQEAKDQSKSLNELNLSSAASIKSLQEEVSKLRETIQKLEAEVELRVDQRNALQQEIY 601 Query: 59 DMKEQISQT----QNQISMIEICRISEEA--KSRAHLSNLNSHLSD 98 +KE++SQ Q+ + +E+ + E+ S L NS L + Sbjct: 602 CLKEELSQIGKKHQSMVEQVELVGLHPESFGSSVKELQEENSKLKE 647 Score = 27.1 bits (57), Expect = 2.8 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLE--DMKEQISQTQNQISMIEICRISE 81 E EV + + R L+E ++EVE LRE L +++++ S Q Q + I + + Sbjct: 247 ESEVSRAQEDSRVLIERATRAEAEVETLRESLSKVEVEKESSLLQYQQCLQNIADLED 304 Score = 27.1 bits (57), Expect = 2.8 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 9/108 (8%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 E+L + + N+R E EV L+ K L+EE + + + + + + D+K ++ Sbjct: 360 ERLHKAEEDSRLTNQRAENAEGEVESLKQKVSKLIEENEAYELQYQQCLDTIADLKLKLF 419 Query: 66 QTQNQISMI--EI------CRISEEAKSRAHLSNLNSHLSDFERLFEK 105 Q + + EI + +EE SN N H S+ + L EK Sbjct: 420 HAQEETQRLSREIEDGVAKLKFAEEKCVVLERSNQNLH-SELDGLLEK 466 >At5g62350.1 68418.m07826 invertase/pectin methylesterase inhibitor family protein / DC 1.2 homolog (FL5-2I22) similar to SP|Q42534 Pectinesterase 2 precursor (EC 3.1.1.11) (Pectin methylesterase 2) (PE 2) {Arabidopsis thaliana}; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor; FL5-2I22 mRNA for DC 1.2 homolog, partial cds GI:11127598 Length = 202 Score = 28.7 bits (61), Expect = 0.92 Identities = 13/55 (23%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Query: 44 GSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRA-HLSNLNSHLS 97 G K EVE +++ +E+M + + + + +++C +++ A H+SN + S Sbjct: 97 GLKKREVEAIKDCVEEMNDTVDRLTKSVQELKLCGSAKDQDQFAYHMSNAQTWTS 151 >At5g55860.1 68418.m06963 expressed protein contains Pfam profile PF05701: Plant protein of unknown function (DUF827); expression supported by MPSS Length = 649 Score = 28.7 bits (61), Expect = 0.92 Identities = 23/107 (21%), Positives = 50/107 (46%), Gaps = 2/107 (1%) Query: 1 MSCCGEKLDLVKLKFKSVNKRK--IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLE 58 ++ E ++ KL K + I EKE+ + K SL + E+ E + Sbjct: 211 IAAVNESVEQTKLACSQARKEQSEIFAEKEIQQKSYKAGMEESAKKSLALKNEFDPEFAK 270 Query: 59 DMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 ++ Q+++T N+I ++ + +A ++ ++ L++ + LFEK Sbjct: 271 KLEVQLTETYNEIDELQKQMETAKASDIDSVNGVSLELNEAKGLFEK 317 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 28.7 bits (61), Expect = 0.92 Identities = 16/77 (20%), Positives = 38/77 (49%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 E+E L K + + + ++ ++ L L +MKE+ + +++ S + + E +S Sbjct: 5 EEENKSLSLKVSEISDVIQQGQTTIQELISELGEMKEKYKEKESEHSSLVELHKTHERES 64 Query: 86 RAHLSNLNSHLSDFERL 102 + + L +H+ E+L Sbjct: 65 SSQVKELEAHIESSEKL 81 Score = 28.7 bits (61), Expect = 0.92 Identities = 16/56 (28%), Positives = 28/56 (50%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 E++ L L EL SL+ + LE K++ S+ NQI+ ++ + +EA Sbjct: 978 EIMALTELINNLKNELDSLQVQKSETEAELEREKQEKSELSNQITDVQKALVEQEA 1033 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/75 (21%), Positives = 36/75 (48%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 E+E L + + +EL +S+V+ L L + K+ ++Q +N++S + + S Sbjct: 512 EEEKKSLSSMILEITDELKQAQSKVQELVTELAESKDTLTQKENELSSFVEVHEAHKRDS 571 Query: 86 RAHLSNLNSHLSDFE 100 + + L + + E Sbjct: 572 SSQVKELEARVESAE 586 >At5g07820.1 68418.m00896 expressed protein Length = 561 Score = 28.7 bits (61), Expect = 0.92 Identities = 29/98 (29%), Positives = 49/98 (50%), Gaps = 13/98 (13%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEE-----------LGSLKSEVEYLR 54 EK L K +++ K KE+ + L+NKE+ ++E L ++S VE + Sbjct: 262 EKTSLDAQKVSRISENKNSKEERLKNLKNKEKTNIDEPVRPDDAVEKTLYVVESSVEKKK 321 Query: 55 ERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNL 92 +++ +IS+TQ Q S +I R S KS + L +L Sbjct: 322 KKMSTKSVKISETQ-QSSEKKIIR-STGKKSLSLLPSL 357 Score = 25.4 bits (53), Expect = 8.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEE 42 C + L+ L+ K V++ K + L+NKE+A ++E Sbjct: 215 CDDVLEKTDLEVKKVSRISENKSSKEDTLKNKEKAKIDE 253 >At4g30790.1 68417.m04362 expressed protein Length = 1148 Score = 28.7 bits (61), Expect = 0.92 Identities = 16/75 (21%), Positives = 33/75 (44%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRA 87 E+++ NK + +L EV L LE ++ + ++Q + +E C +++ Sbjct: 820 ELMEKSNKLSEMESKLNGAMEEVSNLSRELETNQKLLEESQMNCAHLENCLHEAREEAQT 879 Query: 88 HLSNLNSHLSDFERL 102 HL + S + L Sbjct: 880 HLCAADRRASQYTAL 894 >At4g04396.1 68417.m00632 hypothetical protein Length = 140 Score = 28.7 bits (61), Expect = 0.92 Identities = 13/52 (25%), Positives = 27/52 (51%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEIC 77 ++EV+ K + EL +KSE + L L+++KE+ + + ++C Sbjct: 57 QEEVVDALEKFGIIANELNKIKSEAKELHVMLQELKEEAELGKKKFRKWKVC 108 >At4g03000.2 68417.m00408 expressed protein contains similarity to hypothetical proteins Length = 814 Score = 28.7 bits (61), Expect = 0.92 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEI 76 + + KEKE + KE+ LLEE ++K E + L + Q+ +T N I +E+ Sbjct: 508 KALRKEKEEAEEFRKEKQLLEE-NTIKRRSE-MELALNNATNQLERTNNTIRRLEL 561 Score = 25.8 bits (54), Expect = 6.5 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Query: 35 KERALLEELGSLKSEVEYLRERLE-DMK---EQISQTQNQISMIEI 76 KER LEELG K+E E ++ + E D+K E I + +IS +++ Sbjct: 659 KERGKLEELG--KAEEERIKTKAENDVKYYIENIKRLDTEISKLKL 702 >At4g03000.1 68417.m00407 expressed protein contains similarity to hypothetical proteins Length = 814 Score = 28.7 bits (61), Expect = 0.92 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEI 76 + + KEKE + KE+ LLEE ++K E + L + Q+ +T N I +E+ Sbjct: 508 KALRKEKEEAEEFRKEKQLLEE-NTIKRRSE-MELALNNATNQLERTNNTIRRLEL 561 Score = 25.8 bits (54), Expect = 6.5 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 6/46 (13%) Query: 35 KERALLEELGSLKSEVEYLRERLE-DMK---EQISQTQNQISMIEI 76 KER LEELG K+E E ++ + E D+K E I + +IS +++ Sbjct: 659 KERGKLEELG--KAEEERIKTKAENDVKYYIENIKRLDTEISKLKL 702 >At3g55060.1 68416.m06115 expressed protein contains weak similarity to intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae]; expression supported by MPSS Length = 896 Score = 28.7 bits (61), Expect = 0.92 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 8/88 (9%) Query: 18 VNKRKIMKEKEVLKLRNKERALLEELGSLKSEVE-------YLRERLEDMKEQISQTQNQ 70 V ++ KEKE+ +L+ + A + L+ EV+ L+D+K Q+ + + Sbjct: 744 VREKLYSKEKEIEQLQAELAAAVRGNEILRCEVQSSLDNLSVTTHELKDLKHQMLKKEES 803 Query: 71 ISMIEICRISEEAKSRAHLSNLNSHLSD 98 I +E + E AK A L+ L S +S+ Sbjct: 804 IRRLE-SNLQEAAKEMARLNALLSKVSN 830 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 28.7 bits (61), Expect = 0.92 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 K+++ + K+ I K+K + +L +ER ++EE+ +K E+ R E K + + + Sbjct: 736 KIQYAEIEKKSI-KDK-LPQLEQEERNIIEEIDRIKPELSKAIARTEVDKRKTEMNKLEK 793 Query: 72 SMIEIC-RISEEAKSRAHLSNL 92 M EI RI ++ + N+ Sbjct: 794 RMNEIVDRIYKDFSQSVGVPNI 815 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 28.7 bits (61), Expect = 0.92 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI--SMIEICRISEE 82 +KEV ++KE +++ L++++E L+++L D Q Q Q+ +E+ IS E Sbjct: 1045 QKEVNDFQSKENVTEKQVEILETQMEELQDKLRDTTMDNEQLQEQLRGKDMELLIISNE 1103 Score = 25.4 bits (53), Expect = 8.6 Identities = 18/101 (17%), Positives = 43/101 (42%), Gaps = 1/101 (0%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 GE++ ++ + + MK E+ L + EEL + +V+ + + +K++ Sbjct: 1895 GERVIFLESSITGLQQELAMKASELYSLEHSRSVTAEELDIKERDVQVYADIVSSLKKEN 1954 Query: 65 SQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 +N+ + +R ++ SHL++ + EK Sbjct: 1955 VSLKNKFIHFGEDQFKALDVTRLSIAKC-SHLTEDSKKLEK 1994 >At2g34580.1 68415.m04248 hypothetical protein Length = 203 Score = 28.7 bits (61), Expect = 0.92 Identities = 24/102 (23%), Positives = 52/102 (50%), Gaps = 5/102 (4%) Query: 10 LVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 +++ K + N + + + L +K + +++L +LK EVE L+E L++ +E+ + + Sbjct: 55 MLEQKIAAQNLKITILRSNIDDLDSKYHSYIQQLRTLKIEVEELKE-LDEEREKYYKVKC 113 Query: 70 QISMIEICRISEEAKS--RAHLSNLNSHLSDFERLFEKGFIL 109 M E + E +S R + NL + + + + G+IL Sbjct: 114 S-EMNEFMQNVERFRSENRLQIENLRNRIKE-SNMMNIGYIL 153 >At1g27920.1 68414.m03421 microtubule associated protein (MAP65/ASE1) family protein low similarity to protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 592 Score = 28.7 bits (61), Expect = 0.92 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 5/53 (9%) Query: 10 LVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKE 62 LVK K V ++K+ EV + A+L+E L+ E E ++RL +MK+ Sbjct: 474 LVKAKSWEVERQKVFLYNEVPLV-----AMLQEYNKLRQEKEMEKQRLREMKK 521 >At1g05640.1 68414.m00585 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 627 Score = 28.7 bits (61), Expect = 0.92 Identities = 17/78 (21%), Positives = 42/78 (53%), Gaps = 3/78 (3%) Query: 22 KIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ--TQNQISMIEICRI 79 KI + V L+ A ++LG ++ + L + + D+K ++ Q++ + + + RI Sbjct: 367 KIGNPELVSVLKEAGAATAKDLGKPRNPAKQLNQTVSDIKHEVQSQLQQSRQTGVRVRRI 426 Query: 80 SEEAKSRAHLSNLNSHLS 97 ++ K + H++ LN+ ++ Sbjct: 427 AKRLK-KLHINGLNNAIN 443 >At5g64180.1 68418.m08058 expressed protein Length = 158 Score = 28.3 bits (60), Expect = 1.2 Identities = 20/87 (22%), Positives = 36/87 (41%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 +LD K E ++ + + +EL + + E L M+EQIS+ Sbjct: 71 ELDAAITAAAHARSEKRQAESSQKAAESRAQDVTKELENTTKVFKLHMEELRGMQEQISK 130 Query: 67 TQNQISMIEICRISEEAKSRAHLSNLN 93 N+I ++E + K R S++N Sbjct: 131 RDNEIKLLEAIIQTLGGKERLGKSDVN 157 >At5g62250.1 68418.m07816 microtubule associated protein (MAP65/ASE1) family protein low similarity to protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 549 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/46 (34%), Positives = 24/46 (52%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 KE E L N+ ++LEE L+ E E R R D+K+ Q ++ Sbjct: 451 KEYEFLFDGNRLLSMLEEYTELREEKEQERRRKRDLKKHQGQVTSE 496 >At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-containing protein low similarity to microrchidia [Homo sapiens] GI:5410257; contains Pfam profile PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein Length = 823 Score = 28.3 bits (60), Expect = 1.2 Identities = 18/48 (37%), Positives = 31/48 (64%), Gaps = 2/48 (4%) Query: 20 KRKIMKEKEVLKLRNKERALLEELG-SLKSEVEYLRERLEDM-KEQIS 65 + ++ K++EV L K+ EL +L++EVE L+ +L++M KEQ S Sbjct: 731 RERLDKKEEVFLLLQKDLRRERELRKTLEAEVETLKNKLKEMDKEQAS 778 >At5g37130.1 68418.m04457 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 856 Score = 28.3 bits (60), Expect = 1.2 Identities = 18/72 (25%), Positives = 36/72 (50%), Gaps = 1/72 (1%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ-ISMI 74 K +K + KEVLKL + E + +V + E +++ + TQN+ IS++ Sbjct: 626 KKKSKESFIAFKEVLKLNRDSWQIWENFSHVAMDVGNTDQAFEAIQQIMRLTQNKSISVV 685 Query: 75 EICRISEEAKSR 86 + R+ + ++R Sbjct: 686 LLDRLMTDLENR 697 >At4g13540.1 68417.m02111 expressed protein Length = 210 Score = 28.3 bits (60), Expect = 1.2 Identities = 13/38 (34%), Positives = 24/38 (63%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKE 62 KE+ +L L+ E +E L+ EV+ LR+++E+ +E Sbjct: 36 KERVILALKMAETEWRKERKRLREEVKRLRQKMEEKEE 73 >At3g53350.3 68416.m05888 myosin heavy chain-related low similarity to filamin-interacting protein S-FILIP [Rattus norvegicus] GI:21392397, nonmuscle heavy chain myosin II-A [Mus musculus] GI:17978023 Length = 394 Score = 28.3 bits (60), Expect = 1.2 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 21 RKIMKEKEVLKLR--NKERALLEELGSLKSEVEYLR-ERLEDMKEQIS 65 R ++ E +K R +E L EEL K E+E LR E +E +KE S Sbjct: 250 RSAYEQTEAVKSRYSQREAELTEELNRTKDEIEGLRKELMEKVKEDES 297 >At3g53350.2 68416.m05887 myosin heavy chain-related low similarity to filamin-interacting protein S-FILIP [Rattus norvegicus] GI:21392397, nonmuscle heavy chain myosin II-A [Mus musculus] GI:17978023 Length = 394 Score = 28.3 bits (60), Expect = 1.2 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 21 RKIMKEKEVLKLR--NKERALLEELGSLKSEVEYLR-ERLEDMKEQIS 65 R ++ E +K R +E L EEL K E+E LR E +E +KE S Sbjct: 250 RSAYEQTEAVKSRYSQREAELTEELNRTKDEIEGLRKELMEKVKEDES 297 >At3g53350.1 68416.m05886 myosin heavy chain-related low similarity to filamin-interacting protein S-FILIP [Rattus norvegicus] GI:21392397, nonmuscle heavy chain myosin II-A [Mus musculus] GI:17978023 Length = 396 Score = 28.3 bits (60), Expect = 1.2 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 21 RKIMKEKEVLKLR--NKERALLEELGSLKSEVEYLR-ERLEDMKEQIS 65 R ++ E +K R +E L EEL K E+E LR E +E +KE S Sbjct: 252 RSAYEQTEAVKSRYSQREAELTEELNRTKDEIEGLRKELMEKVKEDES 299 >At2g42470.1 68415.m05254 meprin and TRAF homology domain-containing protein / MATH domain-containing protein contains Pfam profile PF00917: MATH domain Length = 898 Score = 28.3 bits (60), Expect = 1.2 Identities = 12/45 (26%), Positives = 26/45 (57%) Query: 56 RLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 R++ ++E + + +S +++ E+AKS A + +L LSD + Sbjct: 752 RIQQLEEHVKNLEQTVSDLKVEMDKEKAKSTAKVLSLEDTLSDLK 796 >At2g25320.1 68415.m03029 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 1663 Score = 28.3 bits (60), Expect = 1.2 Identities = 27/84 (32%), Positives = 41/84 (48%), Gaps = 8/84 (9%) Query: 21 RKIMKEKEVL--KLRNKERA---LLEELGSLKSEV---EYLRERLEDMKEQISQTQNQIS 72 +K+ KEK L KL+ E A EEL +E E LR+ LED Q++QT Q Sbjct: 1464 KKVGKEKNALTEKLKVTEAARKRFEEELKRYATENVTREELRKSLEDQIRQLTQTVGQTK 1523 Query: 73 MIEICRISEEAKSRAHLSNLNSHL 96 + + + A+ A++ + S L Sbjct: 1524 EEKREKEDQIARCEAYIDGMESKL 1547 Score = 25.4 bits (53), Expect = 8.6 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELG-SLKSEVEYLRERLEDMKEQISQTQNQ 70 KLK +++ +E LK E EEL SL+ ++ L + + KE+ + ++Q Sbjct: 1476 KLKVTEAARKRFEEE---LKRYATENVTREELRKSLEDQIRQLTQTVGQTKEEKREKEDQ 1532 Query: 71 ISMIEICRISEEAKSRA 87 I+ E E+K +A Sbjct: 1533 IARCEAYIDGMESKLQA 1549 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 28.3 bits (60), Expect = 1.2 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM 73 K + ++K +E E + R +ER EE+ K E E R+ E+++ + + Q + Sbjct: 500 KRREEERKKREEEAEQARKREEEREKEEEMAK-KREEERQRKEREEVERKRREEQERKRR 558 Query: 74 IEICRISEEAKSR 86 E R EE + R Sbjct: 559 EEEARKREEERKR 571 Score = 26.6 bits (56), Expect = 3.7 Identities = 20/83 (24%), Positives = 41/83 (49%), Gaps = 2/83 (2%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 C E +L KL + + +RK +E+E+ + R +E + + + E E + R E+ E+ Sbjct: 420 CAEG-ELSKL-MREIEERKRREEEEIERRRKEEEEARKREEAKRREEEEAKRREEEETER 477 Query: 64 ISQTQNQISMIEICRISEEAKSR 86 + + + E R EE +++ Sbjct: 478 KKREEEEARKREEERKREEEEAK 500 Score = 26.2 bits (55), Expect = 4.9 Identities = 17/62 (27%), Positives = 30/62 (48%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAK 84 +E+E K R +ER EE + E RE+ E+M ++ + + + E+ R E + Sbjct: 494 REEEEAKRREEERKKREEEAEQARKREEEREKEEEMAKKREEERQRKEREEVERKRREEQ 553 Query: 85 SR 86 R Sbjct: 554 ER 555 Score = 25.4 bits (53), Expect = 8.6 Identities = 15/73 (20%), Positives = 37/73 (50%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM 73 K + +++ +E+ K+R ++ EE + + E E ++ E+M+ + + + + Sbjct: 577 KRREQERQRKEREEVERKIREEQERKREEEMAKRREQERQKKEREEMERKKREEEARKRE 636 Query: 74 IEICRISEEAKSR 86 E+ +I EE + R Sbjct: 637 EEMAKIREEERQR 649 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 28.3 bits (60), Expect = 1.2 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + +RK +E+E L+ +ER EEL + E + R+R E KE++ + + + ++ Sbjct: 424 QEAEERKKKEEEEKLRKEEEERRRQEELEAQAEEAK--RKRKEKEKEKLLRKKLEGKLLT 481 Query: 76 ICRISEEAKSRAHLSNL 92 + +E K A + L Sbjct: 482 AKQKTEAQKREAFKNQL 498 >At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1201 Score = 28.3 bits (60), Expect = 1.2 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 2/77 (2%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + +RK +E+E L+ +ER EEL + E + R+R E KE++ + + + ++ Sbjct: 377 QEAEERKKKEEEEKLRKEEEERRRQEELEAQAEEAK--RKRKEKEKEKLLRKKLEGKLLT 434 Query: 76 ICRISEEAKSRAHLSNL 92 + +E K A + L Sbjct: 435 AKQKTEAQKREAFKNQL 451 >At1g67230.1 68414.m07652 expressed protein Length = 1132 Score = 28.3 bits (60), Expect = 1.2 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 12/88 (13%) Query: 22 KIMKEKEVLKLRNKERA--------LLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM 73 +I KEK+ L++ +ER+ L E++ +S+ E L++ ED+K Q + + Sbjct: 468 EINKEKDELRVTEEERSEYLRLQTELKEQIEKCRSQQELLQKEAEDLKAQRESFEKEWEE 527 Query: 74 IEICRISEEAKSRAHLSNLNSHLSDFER 101 ++ +AK L N+ ER Sbjct: 528 LD----ERKAKIGNELKNITDQKEKLER 551 >At1g53490.1 68414.m06064 bZIP protein Length = 229 Score = 28.3 bits (60), Expect = 1.2 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 4/71 (5%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 EK++ V ++ + KR M E+EV L ++ L E+ SE + +L++M +Q+ Sbjct: 43 EKMEQVHTAYQKMGKRCQMMEQEVENLTKDKQELQEKF----SEKSRQKRKLDEMYDQLR 98 Query: 66 QTQNQISMIEI 76 + I Sbjct: 99 SEYESVKRTAI 109 >At1g29270.1 68414.m03579 expressed protein Length = 123 Score = 28.3 bits (60), Expect = 1.2 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Query: 37 RALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISE----EAKSRAHLSNL 92 R L + LK E+E L+ ED+K ++ +Q +++ +I E + KS +NL Sbjct: 4 REALLYIAMLKLEIEALQREYEDLKITKKESLHQFQEVKVEKIGEMFQVKIKSPRGENNL 63 Query: 93 NSHLSDFERL 102 + L FE + Sbjct: 64 VNILEAFEEM 73 >At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3) Similar to Arabidopsis luminal binding protein (gb|D89342); contains Pfam domain PF00012: dnaK protein Length = 678 Score = 28.3 bits (60), Expect = 1.2 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 5/72 (6%) Query: 6 EKLDLV-KLKFKSVNKRKIMKEKEVL--KLRNKERALLEELGSLKSEVEYLRERLEDMKE 62 EK+D KL+ N + + +KE L K+ ++++ +E G LK +E+L E + KE Sbjct: 579 EKIDARNKLETYVYNMKSTVADKEKLAKKISDEDKEKME--GVLKEALEWLEENVNAEKE 636 Query: 63 QISQTQNQISMI 74 + ++ ++ Sbjct: 637 DYDEKLKEVELV 648 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 27.9 bits (59), Expect = 1.6 Identities = 12/40 (30%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDM 60 RK ++++E+ K KER + E+G LK + E +++++ + Sbjct: 17 RKQIRKREI-KRNKKERQKVREVGILKKDPEQIKDQIRKL 55 >At5g41140.1 68418.m05001 expressed protein Length = 983 Score = 27.9 bits (59), Expect = 1.6 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Query: 13 LKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQIS 72 LK K + + E + + + L E+ K E+E LR LE+ ++ +T+ +S Sbjct: 703 LKTKEMKRMSADLEYQKRQKEDVNADLTHEITRRKDEIEILRLDLEETRKSSMETEASLS 762 Query: 73 MIEICRISEEAKS 85 E+ RI +E ++ Sbjct: 763 E-ELQRIIDEKEA 774 Score = 27.1 bits (57), Expect = 2.8 Identities = 15/85 (17%), Positives = 42/85 (49%), Gaps = 1/85 (1%) Query: 22 KIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS-QTQNQISMIEICRIS 80 ++ E ++ +L K +E+ + +++EY + + ED+ ++ + + IEI R+ Sbjct: 687 RVEYEAKLNELSGKTDLKTKEMKRMSADLEYQKRQKEDVNADLTHEITRRKDEIEILRLD 746 Query: 81 EEAKSRAHLSNLNSHLSDFERLFEK 105 E ++ + S + +R+ ++ Sbjct: 747 LEETRKSSMETEASLSEELQRIIDE 771 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 27.9 bits (59), Expect = 1.6 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 5/72 (6%) Query: 5 GEKLDLVKLKFKSVNKRKI-MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 G K L K K K NKR++ M EK L + N + E+LG L ++ LR+R D+ + Sbjct: 456 GRKGKLPKPKAKDPNKREMTMDEKGKLGV-NLQELPPEKLGQL---IQILRKRTRDLPQD 511 Query: 64 ISQTQNQISMIE 75 + + I ++ Sbjct: 512 GDEIELDIEALD 523 >At4g36740.1 68417.m05213 homeobox-leucine zipper family protein similar to CRHB7 (GP:3868841) {Ceratopteris richardii} and to homeotic protein VAHOX1 (PIR:T07734) [Lycopersicon esculentum] Length = 217 Score = 27.9 bits (59), Expect = 1.6 Identities = 14/46 (30%), Positives = 27/46 (58%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 E+E KL+N ++ + L+SEV L+E+L D + +I + ++ Sbjct: 114 EEEYNKLKNSHDNVVVDKCRLESEVIQLKEQLYDAEREIQRLAERV 159 >At4g18880.1 68417.m02784 heat shock transcription factor 21 (HSF21) identical to heat shock transcription factor 21 [Arabidopsis thaliana] GI:3399765; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 401 Score = 27.9 bits (59), Expect = 1.6 Identities = 17/89 (19%), Positives = 44/89 (49%), Gaps = 2/89 (2%) Query: 19 NKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ-NQISMIE-I 76 + ++ ++ +L ++ LLEEL E E +++++KE++ + Q +M+ + Sbjct: 125 DSERVRMNNQIERLTKEKEGLLEELHKQDEEREVFEMQVKELKERLQHMEKRQKTMVSFV 184 Query: 77 CRISEEAKSRAHLSNLNSHLSDFERLFEK 105 ++ E+ +LS ++ +R F + Sbjct: 185 SQVLEKPGLALNLSPCVPETNERKRRFPR 213 >At3g51720.1 68416.m05671 expressed protein contains Pfam PF05701: Plant protein of unknown function (DUF827) Length = 407 Score = 27.9 bits (59), Expect = 1.6 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Query: 15 FKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 FK +N+ K+ + K A+ +G L +E R LE +E+++ + Sbjct: 105 FKELNQAKM----NLCKTTKDLAAIRVSVGLLNKRLEEERAALEKTRERLNSENAAEMSM 160 Query: 75 EICRISEEAK 84 EI R+S EAK Sbjct: 161 EIQRLSYEAK 170 >At3g47640.1 68416.m05186 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 240 Score = 27.9 bits (59), Expect = 1.6 Identities = 13/44 (29%), Positives = 25/44 (56%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 ++ LR + +LL E + +E L+E ++ +IS+ QN+I Sbjct: 80 QIESLRKEHASLLSESSYVTTEKNELKEETSVLETEISKLQNEI 123 >At3g07190.1 68416.m00857 expressed protein Length = 220 Score = 27.9 bits (59), Expect = 1.6 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 GE +L K + + K + KE+ +L+ K + E L L+ E + +LE + + Sbjct: 127 GELEELRKERIELKEKEE-KTSKEIKQLKEKLSCVSENLKKLEKESKEKETKLETAEAHV 185 Query: 65 SQTQNQIS--MIEICRISEE 82 + Q Q S ++E R+ E+ Sbjct: 186 TALQKQSSELLLEYDRLLED 205 Score = 27.5 bits (58), Expect = 2.1 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Query: 39 LLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI--EICRISEEAK 84 L +GS K E+E LR+ ++KE+ +T +I + ++ +SE K Sbjct: 118 LRSNVGSSKGELEELRKERIELKEKEEKTSKEIKQLKEKLSCVSENLK 165 >At3g02930.1 68416.m00288 expressed protein ; expression supported by MPSS Length = 806 Score = 27.9 bits (59), Expect = 1.6 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 5/98 (5%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMK---E 62 ++ + +K + ++VN+ K K+ + + LLEE + SE+E +E E K E Sbjct: 397 KEAEKLKNELETVNEEKTQALKKEQDATSSVQRLLEEKKKILSELESSKEEEEKSKKAME 456 Query: 63 QISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 ++ +++S E + E+ SR N + + D + Sbjct: 457 SLASALHEVSS-ESRELKEKLLSRGD-QNYETQIEDLK 492 Score = 25.4 bits (53), Expect = 8.6 Identities = 21/98 (21%), Positives = 47/98 (47%), Gaps = 9/98 (9%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 EK ++V+ ++V +++ +KE+ ++N+ + L + E+E + + L + K+ S Sbjct: 148 EKFEVVEAGIEAVQRKEEELKKELENVKNQHASESATLLLVTQELENVNQELANAKDAKS 207 Query: 66 QTQNQISMIEICRISEEAKSRA-HLSNLNSHLSDFERL 102 + +CR + +K A H + S+ RL Sbjct: 208 KA--------LCRADDASKMAAIHAEKVEILSSELIRL 237 >At1g69120.1 68414.m07909 floral homeotic protein APETALA1 (AP1) / agamous-like MADS box protein (AGL7) identical to SP|P35631 Floral homeotic protein APETALA1 (AGL7 protein) {Arabidopsis thaliana} Length = 256 Score = 27.9 bits (59), Expect = 1.6 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 3/65 (4%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 ++LD LK K ++M E + +L+ KE+A+ E+ L +++ + L +EQ Sbjct: 130 QQLDTA-LKHIRTRKNQLMYES-INELQKKEKAIQEQNSMLSKQIKEREKILRAQQEQWD 187 Query: 66 QTQNQ 70 Q QNQ Sbjct: 188 Q-QNQ 191 >At1g64690.1 68414.m07333 expressed protein Length = 273 Score = 27.9 bits (59), Expect = 1.6 Identities = 14/62 (22%), Positives = 31/62 (50%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 +E+ LK+E++Y R+ + I + + + R +EE +++ L+S S+ Sbjct: 82 DEIKELKAELDYERKARRRAELMIKKLAKDVEEERMAREAEEMQNKRLFKELSSEKSEMV 141 Query: 101 RL 102 R+ Sbjct: 142 RM 143 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/53 (30%), Positives = 32/53 (60%), Gaps = 4/53 (7%) Query: 10 LVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKE 62 ++K K V + ++ +E E +++NK L +EL S KSE+ ++ LE+ ++ Sbjct: 104 MIKKLAKDVEEERMAREAE--EMQNKR--LFKELSSEKSEMVRMKRDLEEERQ 152 >At1g20100.1 68414.m02515 expressed protein Length = 285 Score = 27.9 bits (59), Expect = 1.6 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED--MKEQISQTQ 68 RK KEK+ K KE+ LE+ S V Y E+LE + E+ Q Q Sbjct: 40 RKEKKEKKKEKKLKKEKKSLEQKYSTTKTVSYESEQLEKSCLTEEFEQPQ 89 >At5g59760.1 68418.m07490 hypothetical protein Length = 221 Score = 27.5 bits (58), Expect = 2.1 Identities = 21/87 (24%), Positives = 44/87 (50%), Gaps = 6/87 (6%) Query: 19 NKRKIMKEKEVLKLR--NKERALLEELGSLKSEVEYLRERLEDMKEQISQ----TQNQIS 72 N + + E E LK+ K R EE+ L + +++ ++ ++ ++Q+SQ TQ + Sbjct: 10 NLQSTLFELETLKMEANEKSRTHREEVNQLLNLLKFTQQERDEARQQLSQFIFHTQQNPN 69 Query: 73 MIEICRISEEAKSRAHLSNLNSHLSDF 99 + + + + S+ S+ +S LS F Sbjct: 70 SRSLTKSNSFSHSQDVSSSSSSELSTF 96 >At5g51600.1 68418.m06397 microtubule associated protein (MAP65/ASE1) family protein low similarity to SP|P50275 Anaphase spindle elongation protein {Saccharomyces cerevisiae}, protein regulating cytokinesis 1 (PRC1) [Homo sapiens] GI:2865521; contains Pfam profile PF03999: Microtubule associated protein (MAP65/ASE1 family) Length = 707 Score = 27.5 bits (58), Expect = 2.1 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQ--ISMIEICRISEEAKSRAHL 89 + +GSLK E+ + LE+M+++ + +NQ + M +I I+ + K + L Sbjct: 96 QSVGSLKQELGRILPELEEMQKRKVERRNQFIVVMEQIDSITNDIKGQGEL 146 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 27.5 bits (58), Expect = 2.1 Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Query: 42 ELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFER 101 EL + + +RE++ + Q +N++S +E+ E AKS+ + +LNS + E+ Sbjct: 727 ELSKIVDMLNNIREKVGNAVRQYRAAENEVSGLEM----ELAKSQREIESLNSEHNYLEK 782 >At5g42570.1 68418.m05183 expressed protein low similarity to SP|P51572 B-cell receptor-associated protein 31 (6C6-AG tumor-associated antigen) (DXS1357E) {Homo sapiens} Length = 218 Score = 27.5 bits (58), Expect = 2.1 Identities = 14/60 (23%), Positives = 30/60 (50%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 GE++ +K K K++ K KE+ + + AL ++ E + L E ++++ Q+ Sbjct: 146 GEEIAALKAKIKTLESESESKGKELKGAQGETEALRKQADGFLMEYDRLLEDNQNLRNQL 205 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 27.5 bits (58), Expect = 2.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Query: 33 RNKERALLEELGSLKSEVEYLRERLEDMK 61 R +E+ E+ EVEYL+++L++MK Sbjct: 945 RTEEKKTEAEVAETTMEVEYLKKKLDEMK 973 >At5g13130.1 68418.m01504 hypothetical protein low similarity to microrchidia [Mus musculus] GI:5410255 Length = 706 Score = 27.5 bits (58), Expect = 2.1 Identities = 16/37 (43%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKE-RALLEEL 43 L+L + K K N K +EKEVL+L+ KE +A ++ L Sbjct: 618 LELQESKAKIQNLEKAQREKEVLELQLKESKARIQNL 654 >At4g01480.1 68417.m00191 inorganic pyrophosphatase, putative [soluble] / pyrophosphate phospho-hydrolase, putative / PPase, putative strong similarity to SP|Q43187 Soluble inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho- hydrolase) (PPase) {Solanum tuberosum}; contains Pfam profile PF00719: inorganic pyrophosphatase Length = 216 Score = 27.5 bits (58), Expect = 2.1 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 52 YLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSH-LSDFERLFE 104 +LR R + I Q + +I +C E K +++ L H LS+ R FE Sbjct: 121 FLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHITNINELPPHRLSEIRRFFE 174 >At3g23210.1 68416.m02926 basic helix-loop-helix (bHLH) family protein similar to hypothetical protein GB:CAB10220 from [Arabidopsis thaliana] Length = 320 Score = 27.5 bits (58), Expect = 2.1 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI-SMI 74 E +L+ + LLEE+ SLK++ LRE +K + + + Q+ SM+ Sbjct: 216 EAHELQETNQKLLEEIKSLKADKNELREEKLVLKAEKEKMEQQLKSMV 263 >At3g12540.1 68416.m01560 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 503 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/47 (25%), Positives = 29/47 (61%) Query: 29 VLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 +L L + + L+EEL ++++E+ L +R++D+K + + + +E Sbjct: 31 LLLLPPQVQELIEELATVEAEILCLEKRIQDLKLDVYSEKKENKELE 77 >At3g10180.1 68416.m01219 kinesin motor protein-related similar to centromere protein E GB:4502781 [Homo sapiens] Length = 1348 Score = 27.5 bits (58), Expect = 2.1 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 9/86 (10%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 +K ++ +L+ K E+E+L LRN LKSE+E R LE +E+ + Sbjct: 346 QKKEIEELRSKLKTSHSDHSEEEILNLRNT---------LLKSELERERIALELEEEKKA 396 Query: 66 QTQNQISMIEICRISEEAKSRAHLSN 91 Q Q + + E + + S LSN Sbjct: 397 QAQRERVLQEQAKKIKNLSSMVLLSN 422 Score = 27.5 bits (58), Expect = 2.1 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Query: 24 MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 ++E+ + KE AL G L SE+ L E+LE ++ QN ++ ++ R+ + Sbjct: 920 LEEELAAERGEKEEALCRNDG-LGSEITDLTEKLEHSNTKLEHLQNDVTELK-TRLEVSS 977 Query: 84 KSRAHL-SNLNSHLSDFERL 102 + L +N+ L + E L Sbjct: 978 SDQQQLETNVKQLLEEKEEL 997 >At2g38830.1 68415.m04771 tumor susceptibility protein-related contains weak similarity to Swiss-Prot:Q99816 tumor susceptibility gene 101 protein [Homo sapiens] Length = 331 Score = 27.5 bits (58), Expect = 2.1 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 3/77 (3%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLR--ERLEDMKEQISQTQNQISMIEICRISEEA 83 E LKL + + +EE+ ++SEVE L + +ED+ + + + +EI ++ Sbjct: 250 EMNYLKLTSMDMGRIEEMFEIESEVEGLAGDDAIEDVLRVLEEAAER-GELEIGSYLKQV 308 Query: 84 KSRAHLSNLNSHLSDFE 100 + A HLS F+ Sbjct: 309 RVLAREQFFLKHLSSFK 325 >At2g31150.1 68415.m03803 expressed protein Length = 309 Score = 27.5 bits (58), Expect = 2.1 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 2/69 (2%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 EKE+++L K + L + K E + E + + S+T + S++++ R +S Sbjct: 69 EKEIVELFKKVQVQLRARAAAKKEEKKTEEASKGQGGKESETVD--SLLKLLRKHSGEQS 126 Query: 86 RAHLSNLNS 94 + +SN NS Sbjct: 127 KKQVSNFNS 135 >At2g18550.1 68415.m02161 homeobox-leucine zipper family protein similar to CRHB6 (GI:3868839) [Ceratopteris richardii]; contains Pfam PF00046: Homeobox domain Length = 220 Score = 27.5 bits (58), Expect = 2.1 Identities = 14/46 (30%), Positives = 25/46 (54%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 E E KL+N + E L SEV +L+E+L + + +I + ++ Sbjct: 119 EDEYTKLKNAYETTVVEKCRLDSEVIHLKEQLYEAEREIQRLAKRV 164 >At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 534 Score = 27.5 bits (58), Expect = 2.1 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED 59 C +K + + KS++KRK+++ K++ +R +E +L+ L + VE+ R ED Sbjct: 102 CTDKSNGREYACKSISKRKLIRRKDIEDVR-REVMILQHLTGQPNIVEF-RGAYED 155 >At5g65460.1 68418.m08232 kinesin motor protein-related contains similarity to kinesin heavy chain Length = 1281 Score = 27.1 bits (57), Expect = 2.8 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 10/100 (10%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 +K K N + ++ EV + L +L KSE + ++ + KEQ Q +NQ Sbjct: 510 LKQALKEANDQCVLLYNEVQRAWRVSFTLQSDL---KSENAMVVDKHKIEKEQNFQLRNQ 566 Query: 71 ISMIEICRISEEAKSRAH-----LSNLNSHLSDFERLFEK 105 I+ ++ ++ +E K +A + NL S + D E K Sbjct: 567 IA--QLLQLEQEQKLQAQQQDSTIQNLQSKVKDLESQLSK 604 >At5g65180.2 68418.m08199 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 311 Score = 27.1 bits (57), Expect = 2.8 Identities = 17/65 (26%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRIS 80 +++ +E+ +L+ ++ +EE S S V +LRE L + + ++ Q+QI + + + Sbjct: 95 KELEEEENILRQSVEKLKSVEE--SRTSLVNHLREALREQESELENLQSQIQVAQ--EQT 150 Query: 81 EEAKS 85 EEA++ Sbjct: 151 EEAQN 155 >At5g65180.1 68418.m08198 expressed protein contains Pfam domain, PF04818: Protein of unknown function, DUF618 Length = 439 Score = 27.1 bits (57), Expect = 2.8 Identities = 17/65 (26%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRIS 80 +++ +E+ +L+ ++ +EE S S V +LRE L + + ++ Q+QI + + + Sbjct: 223 KELEEEENILRQSVEKLKSVEE--SRTSLVNHLREALREQESELENLQSQIQVAQ--EQT 278 Query: 81 EEAKS 85 EEA++ Sbjct: 279 EEAQN 283 >At5g51520.1 68418.m06389 invertase/pectin methylesterase inhibitor family protein low similarity to pectinesterase from Lycopersicon esculentum SP|Q43143, Arabidopsis thaliana SP|Q42534; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 204 Score = 27.1 bits (57), Expect = 2.8 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 5/87 (5%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 + L KS + + K +LK+ K A G + E L++ LE+MK+ I + + Sbjct: 74 LNLNVKSAKEATSVVSK-LLKMSQKSTA--GRKGKMLPEALILKDCLEEMKDTIIELKQA 130 Query: 71 ISMIEICRISEEAKSRAHLSNLNSHLS 97 I+ E+ + + H++N+ + +S Sbjct: 131 IT--EMKNLQDGGSMAEHITNVRTWVS 155 >At5g45190.1 68418.m05547 cyclin family protein similar to cyclin T1 [Equus caballus] GI:5052355; contains Pfam profile PF00134: Cyclin, N-terminal domain Length = 579 Score = 27.1 bits (57), Expect = 2.8 Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 DL L+ K KR+ K K++L R +++ L++E ++ E+E ++ +ED K + + Q Sbjct: 426 DLKLLRDKVKAKRE--KAKKLLGERTRKKDLMDEDDLIERELEDVQLAVEDEKTKERKVQ 483 Query: 69 NQ 70 ++ Sbjct: 484 SR 485 >At5g43900.1 68418.m05368 myosin heavy chain (MYA2) nearly identical to PIR|S51824 myosin heavy chain MYA2 [Arabidopsis thaliana] Length = 1505 Score = 27.1 bits (57), Expect = 2.8 Identities = 20/99 (20%), Positives = 44/99 (44%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 +L KLK ++ + + K K + E G+L++ L +++E++ ++ Sbjct: 847 RLHYRKLKKAAITTQCAWRSKVARGELRKLKMAARETGALQAAKNKLEKQVEELTWRLQL 906 Query: 67 TQNQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 + + +E + E AK+++ L L + E L K Sbjct: 907 EKRIRTDLEEAKKQESAKAQSSLEELQLKCKETEALLIK 945 >At4g36120.1 68417.m05141 expressed protein Length = 981 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Query: 21 RKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + ++KE E LKL + A+ EL +E + LE+ ++ IS+ ++Q++ E Sbjct: 741 KSLLKEVEQLKLEKENIAV--ELSRCLQNLESTKAWLEEKEQLISKLKSQLTSSE 793 >At4g32190.1 68417.m04581 centromeric protein-related low similarity to SP|Q02224 Centromeric protein E (CENP-E protein) {Homo sapiens} Length = 783 Score = 27.1 bits (57), Expect = 2.8 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Query: 32 LRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSN 91 L KE L + K E E LRE ++K+Q + I+ E+ ++ EE R L Sbjct: 261 LEEKEEELEISKATKKLEQEKLRETEANLKKQTEEW--LIAQDEVNKLKEETVKR--LGE 316 Query: 92 LNSHLSDFERL 102 N + DF ++ Sbjct: 317 ANETMEDFMKV 327 Score = 25.8 bits (54), Expect = 6.5 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Query: 24 MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 +KE+E+ K+R + +E+ SE E + L E + + + +I ++ R EE Sbjct: 207 LKEEELEKMRQEIANRSKEVSMAISEFESKSQLLSKANEVVKRQEGEIYALQ--RALEEK 264 Query: 84 KSRAHLSNLNSHLSDFERLFE 104 + +S L E+L E Sbjct: 265 EEELEISKATKKLEQ-EKLRE 284 Score = 25.4 bits (53), Expect = 8.6 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Query: 10 LVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 +++L F N R MKE EVL ++ EE+ + +E + L+ +KE+ Sbjct: 608 VMELSFTRENLR--MKEMEVLAVQRALTFKDEEINVVMGRLEAKEQELKKLKEETINDSE 665 Query: 70 QISMI 74 + ++ Sbjct: 666 DLKVL 670 >At4g27595.1 68417.m03964 protein transport protein-related low similarity to SP|P25386 Intracellular protein transport protein USO1 {Saccharomyces cerevisiae} Length = 1212 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 E + LKSE+E LR +LE + + ++Q IE+ + +A Sbjct: 258 EVVSKLKSEIEMLRGKLEKVSILENTLKDQEESIELLHVDLQA 300 >At4g02710.1 68417.m00366 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1111 Score = 27.1 bits (57), Expect = 2.8 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 11/97 (11%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 EK DL + K K++ + E E L+L+ R LL S++SE +L + + ++K+Q+ Sbjct: 633 EKTDL-EGKAKTIGDKLTDAETENLQLK---RNLL----SIRSEKHHLEDEITNVKDQLH 684 Query: 66 QTQNQISMIEICR---ISEEAKSRAHLSNLNSHLSDF 99 + + + I++ + I E K R + S + F Sbjct: 685 EKEKEFEEIKMEKEKLIQEVFKERKQVELWESQAATF 721 >At4g00695.1 68417.m00095 hypothetical protein Length = 176 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/73 (26%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 +LDL+ K V +R + E L + +L LG + +EY+R+R+ED Sbjct: 26 ELDLLISLKKLVIRRAKVSGLEDLVADKFDLKMLRSLGLVL--MEYVRKRVEDDTSLAPS 83 Query: 67 TQNQISMIEICRI 79 ++S+++ C + Sbjct: 84 VVQELSLLDSCNL 96 >At3g58360.1 68416.m06505 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 298 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/72 (26%), Positives = 40/72 (55%), Gaps = 4/72 (5%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 G K+D ++ K ++++K ++E + R +E + EEL SLK + L +LE K ++ Sbjct: 230 GFKVDWLEKKLVEISEKK--NKEEAGETRMQE--INEELESLKQKCLDLEAQLEKEKAEV 285 Query: 65 SQTQNQISMIEI 76 ++ +S ++ Sbjct: 286 FAAKSPLSFNDV 297 >At3g44050.1 68416.m04718 kinesin motor protein-related KLP2 protein, Xenopus laevis, PIR:T30335 Length = 1229 Score = 27.1 bits (57), Expect = 2.8 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 5/79 (6%) Query: 22 KIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRI-- 79 K+ KE + + + KE ELGS+K+ + R E +++++ + +S + Sbjct: 914 KLSKESKETEEKVKEHQ--SELGSIKTVSDQTNARKEVAEKKLAALRCSLSNFASSAVYF 971 Query: 80 -SEEAKSRAHLSNLNSHLS 97 E ++RAH+++ + +L+ Sbjct: 972 QQREERARAHVNSFSGYLN 990 Score = 27.1 bits (57), Expect = 2.8 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 8/91 (8%) Query: 1 MSCCGEKLDLVKLKFKSVNKRKIMKEKEV----LKLRNKERALLEELGSLKSEVEYLRER 56 M EKL V+ + + K+ + EKE+ ++ + E L++ ++ ++ Sbjct: 1073 MKLSREKLASVRKEVDDMTKKSLKLEKEIKTMETEIEKSSKTRTESEMELENTIQE-KQT 1131 Query: 57 LEDMKEQ-ISQTQNQISMIEICRISEEAKSR 86 +++M+EQ +S+ QN I IEI ++ E+ R Sbjct: 1132 IQEMEEQGMSEIQNMI--IEIHQLVFESDLR 1160 >At2g35330.1 68415.m04332 zinc finger (C3HC4-type RING finger) protein-related contains weak hit to Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger); weak similarity to RING finger protein 8 (Swiss-Prot:O76064) [Homo sapiens] Length = 738 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/60 (26%), Positives = 31/60 (51%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 K + +RK +K+ ++ K L EL SL+SE E ++ + + + T ++S +E Sbjct: 410 KQLKERKDWAQKKAMQAAQKVSDELSELKSLRSEREEIQRVKKGKQTREDSTLKKLSEME 469 Score = 26.2 bits (55), Expect = 4.9 Identities = 18/89 (20%), Positives = 43/89 (48%), Gaps = 1/89 (1%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM 73 K K K+ + EK+ +KL+++ A E++ +L + + + ++ + + Q Q Sbjct: 520 KEKKCLKKLLAWEKQKMKLQDEITAEKEKIKALNRALAQITQEEKEYEAKWRQEQKAKEQ 579 Query: 74 IEICRISEEAKSRAHLSNLNSHLSDFERL 102 + + ++ EE +S+ + N + RL Sbjct: 580 V-LAQVEEEQRSKEAIEASNKRKVESLRL 607 >At2g23490.1 68415.m02804 hypothetical protein Length = 132 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/48 (27%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Query: 36 ERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM--IEICRISE 81 ++A+ EE+ SL+ V+Y R+++ + + I + Q ++ + EI +S+ Sbjct: 74 DKAMEEEVSSLRESVDYNRKKVLNHEYLIEEMQKELKVHRAEIVNVSK 121 >At2g16900.1 68415.m01946 expressed protein Length = 382 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/70 (22%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Query: 25 KEKEVLKLRNKERALLE-ELGSLKSEVEYLRERLEDMKEQISQTQNQ-ISMIEICRISEE 82 +++ +++ + +E + E +L ++ EV R R+E+MK ++++ + + + M E+ E+ Sbjct: 312 RQEGLVRSKKQEMEIQEADLARIEKEVAEARLRVEEMKAELAELETERLRMEEMGFKVEK 371 Query: 83 AKSRAHLSNL 92 K + L L Sbjct: 372 YKGKTFLDEL 381 >At1g68880.1 68414.m07883 bZIP transcription factor family protein similar to common plant regulatory factor 6 GI:9650826 from [Petroselinum crispum]; contains Pfam profile: PF00170 bZIP transcription factor Length = 138 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/69 (27%), Positives = 40/69 (57%), Gaps = 3/69 (4%) Query: 18 VNKRKIMKE--KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 + K++ M+E +++L NK ++L++EL + E + E ++E+ S+++ I I Sbjct: 64 MRKQRHMEELWSMLVQLINKNKSLVDELSQARECYEKVIEENMKLREENSKSRKMIGEIG 123 Query: 76 ICR-ISEEA 83 + R +S EA Sbjct: 124 LNRFLSVEA 132 >At1g58210.1 68414.m06610 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) {Petunia integrifolia} Length = 1246 Score = 27.1 bits (57), Expect = 2.8 Identities = 15/68 (22%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 31 KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLS 90 KL K++ +EE K + +ER ++ + + ++ + + E+ R EE + S Sbjct: 572 KLEEKQKISIEEAEIEKGRITTAKERFYALRNKFEKPESDV-LDEVIRTDEEEEDVVQES 630 Query: 91 NLNSHLSD 98 + S D Sbjct: 631 SYESERED 638 >At1g51070.1 68414.m05741 basic helix-loop-helix (bHLH) family protein similar to bHLH transcription factor GI:3757520 from [Arabidopsis thaliana] Length = 226 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/70 (22%), Positives = 35/70 (50%), Gaps = 4/70 (5%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 +K+ ++ + VN+ + E KL++ +L E++ LK E LR+ + +K + Sbjct: 102 DKVAIINDAIRMVNQAR----DEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKE 157 Query: 66 QTQNQISMIE 75 + Q+ I+ Sbjct: 158 RIDQQLKAIK 167 >At1g04160.1 68414.m00406 myosin family protein contains Pfam profiles: PF02736 myosin N-terminal SH3-like domain, PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif, PF01843: DIL domain Length = 1500 Score = 27.1 bits (57), Expect = 2.8 Identities = 19/99 (19%), Positives = 42/99 (42%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 +L KLK ++ + + K K + E G+L+ L +++E++ ++ Sbjct: 848 RLHYRKLKKAAITTQCAWRGKVARKELKNLKMAARETGALQEAKNKLEKQVEELTWRLQL 907 Query: 67 TQNQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 + + +E + E AK + L + + + E L K Sbjct: 908 EKRMRTDLEEAKKQENAKYESSLEEIQNKFKETEALLIK 946 >At5g67240.1 68418.m08475 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 745 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/64 (25%), Positives = 31/64 (48%) Query: 24 MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEA 83 +KE E LK + K E+E L+++L + QI I+ +++ +++ Sbjct: 682 LKEMEELKEKLKAMEFAISCEGHSKEIEELKQKLNAKEHQIQAQDKIIANLKMKLEKKQS 741 Query: 84 KSRA 87 KSR+ Sbjct: 742 KSRS 745 >At5g61200.1 68418.m07677 hypothetical protein Length = 389 Score = 26.6 bits (56), Expect = 3.7 Identities = 15/68 (22%), Positives = 36/68 (52%), Gaps = 3/68 (4%) Query: 31 KLRNKERA--LLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAH 88 +L +K R L +EL + E++YLR+++ ++++ + +E+ R+++ K Sbjct: 72 RLEDKRRIQMLEKELLNCYQEIDYLRDQVNFRSQEMNDLSEHVLDLEV-RVTKSGKLEEE 130 Query: 89 LSNLNSHL 96 ++ L L Sbjct: 131 VNYLREEL 138 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/46 (23%), Positives = 26/46 (56%) Query: 53 LRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSD 98 LR+++EDM QI Q ++ + ++ E+ K++ +L +++ Sbjct: 293 LRDKMEDMARQILQYKDLVKQLKDELKEEKLKAKEEAEDLTQEMAE 338 Score = 25.4 bits (53), Expect = 8.6 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query: 31 KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 KL + L EEL S KSE L + LE ++T+ Q S+ + ++ E S Sbjct: 126 KLEEEVNYLREELCSSKSEQLLLLQELES-----TETELQFSLFSVEKLEESVSS 175 >At5g53020.1 68418.m06585 expressed protein Length = 721 Score = 26.6 bits (56), Expect = 3.7 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLE-DMKEQISQTQNQ-ISMIEICRISEE 82 K+K + + + K L E L + EV+ LRE E D++E S+ Q + +E+ S + Sbjct: 118 KDKAIEEEKRKCELLEERLVKAEKEVQDLRETQERDVQEHSSELWRQKKTFLELA--SSQ 175 Query: 83 AKSRAHLSNLNSHL 96 + A LS N + Sbjct: 176 RQLEAELSRANKQI 189 Score = 26.2 bits (55), Expect = 4.9 Identities = 12/47 (25%), Positives = 25/47 (53%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 ++K L+L + +R L EL ++E LED+ +I++ + + Sbjct: 164 QKKTFLELASSQRQLEAELSRANKQIEAKGHELEDLSLEINKMRKDL 210 >At5g06830.1 68418.m00772 expressed protein contains Pfam profile: PF05600 protein of unknown function (DUF773) Length = 549 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Query: 25 KEKEVLKLRNKER---ALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMI 74 K ++++ + N +R L+ EL K LRE L+D+ + + QN +S I Sbjct: 450 KSRDLIMILNSKRFLDRLVSELEEKKHREVKLRESLKDVGRRRMELQNSLSAI 502 >At5g01910.1 68418.m00110 hypothetical protein Length = 165 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 18 VNKRKIMKEKEVLKLRNK-ERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM 73 V + K KE L L + +L EEL + K ++E LRE E ++ + + + + Sbjct: 25 VKPKAAEKLKENLNLETSIDASLAEELSAFKKKLERLREDRESTEKLLKERDEAMDL 81 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 26.6 bits (56), Expect = 3.7 Identities = 18/72 (25%), Positives = 37/72 (51%), Gaps = 4/72 (5%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED---MKEQISQTQNQIS 72 K N+R+I + +E +L + +A LE+ + +++ +ER E+ KE + Q +N+ Sbjct: 746 KEENERRIKEAREKAELEQRLKATLEQ-EEKERQIKERQEREENERRAKEVLEQAENERK 804 Query: 73 MIEICRISEEAK 84 + E E + Sbjct: 805 LKEALEQKENER 816 Score = 25.8 bits (54), Expect = 6.5 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Query: 10 LVKLKFKSVNKRKI-----MKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 L + + K NK+K+ ++EKE + ERA +E E E +R RL++ KE+ Sbjct: 818 LKETREKEENKKKLREAIELEEKEKRLIEAFERAEIERRLKEDLEQEEMRMRLQEAKER 876 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/37 (32%), Positives = 22/37 (59%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLED 59 + +EKE +L+ + +E+L ++ E E RER +D Sbjct: 1129 VQREKEAERLKRERDLEMEQLRKVEEEREREREREKD 1165 >At4g35110.2 68417.m04989 expressed protein Length = 386 Score = 26.6 bits (56), Expect = 3.7 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Query: 28 EVLKLRNKER-ALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 ++ K++ KE A+L++L S+ EV +LR LE+ + +N+ Sbjct: 270 QLSKVKVKEMLAVLKDLESVNIEVAWLRSVLEEFAQSQEDVENE 313 >At4g35110.1 68417.m04988 expressed protein Length = 386 Score = 26.6 bits (56), Expect = 3.7 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Query: 28 EVLKLRNKER-ALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 ++ K++ KE A+L++L S+ EV +LR LE+ + +N+ Sbjct: 270 QLSKVKVKEMLAVLKDLESVNIEVAWLRSVLEEFAQSQEDVENE 313 >At4g06672.1 68417.m01069 hypothetical protein contains a non-consensus TT donor splice site, supported by homologous protein alignments. Length = 132 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/48 (27%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Query: 36 ERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM--IEICRISE 81 ++A+ EE+ SL+ V+Y R+++ + I + Q ++ + EI +S+ Sbjct: 74 DKAMEEEVSSLRESVDYNRKKVLSHEYLIEEMQKELKVHRAEIVNVSK 121 >At3g51570.1 68416.m05648 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1226 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/49 (26%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 ++++K + K K+ +K ++ +G K E+ L++RLE++KE++ Sbjct: 177 EALSKILLDKTKDAFVYHSKNNSM--SVGREKHEIYGLKQRLEELKEKL 223 >At3g19370.1 68416.m02457 expressed protein Length = 704 Score = 26.6 bits (56), Expect = 3.7 Identities = 14/54 (25%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 ++++ ++ NK +M EV + K L+E++G++++E + L + + MK+ I Sbjct: 277 MEMRRRNANKSDMMMRDEVQSRKLKYDLLMEQIGNVRAENKNLMDII--MKKNI 328 >At3g12400.1 68416.m01545 tumour susceptibility gene 101 (TSG101) family protein contains Pfam profile PF05743: Tumour susceptibility gene 101 protein (TSG101); similar to Tumor susceptibility gene 101 protein (Swiss-Prot:Q99816) [Homo sapiens] Length = 398 Score = 26.6 bits (56), Expect = 3.7 Identities = 15/70 (21%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLE-DMKEQISQTQNQIS 72 K ++NK M +++ +R A EEL SL++ ++ + L +KE + + + Sbjct: 224 KRNAINKMVEMVHSDLVSMRRAREAEAEELLSLQAGLKRREDELNIGLKEMVEEKETLEQ 283 Query: 73 MIEICRISEE 82 ++I ++ + Sbjct: 284 QLQIISMNTD 293 >At2g47020.2 68415.m05874 peptide chain release factor, putative similar to peptide chain release factor 1 [Escherichia coli] GI:147567; contains Pfam profiles PF00472: Peptidyl-tRNA hydrolase domain, PF03462: PCRF domain Length = 348 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/82 (19%), Positives = 38/82 (46%), Gaps = 2/82 (2%) Query: 13 LKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQIS 72 L F+S++ R+ E NKE L + L +++ ++ ++ +K +S++ + Sbjct: 2 LSFRSLSTRQPEYSPEEFSRANKELRKLRDSMLLINDLRAKQKEIDGLKSLVSESSDDKD 61 Query: 73 MIEIC--RISEEAKSRAHLSNL 92 M+++ + E + L L Sbjct: 62 MLDLAVGELDEAVEEEKRLQTL 83 >At2g41350.1 68415.m05104 expressed protein Length = 298 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Query: 18 VNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI----SQTQNQISM 73 ++ RK E++ K + + ALL+ + YL++ L +++ + SQ +N + Sbjct: 138 ISLRKTGVEEKRAKAQKESNALLDYTRKAIQRLTYLKKILAQLEDDVVPCESQMENWKTN 197 Query: 74 IEICRISEE 82 +E+ + EE Sbjct: 198 LEVMAVKEE 206 >At2g20970.1 68415.m02481 hypothetical protein Length = 373 Score = 26.6 bits (56), Expect = 3.7 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query: 44 GSLKSEVEYLRERLEDMKEQISQTQNQI-SMIEICR 78 G ++ +VE ++E +ED K++++ QN I S++E R Sbjct: 168 GEVREQVEKMKELVEDGKKRVTVMQNIIHSVLETQR 203 >At2g04038.1 68415.m00382 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor Length = 166 Score = 26.6 bits (56), Expect = 3.7 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 7/90 (7%) Query: 20 KRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRI 79 +R + + + R +++ L+EL S + L D ++S+TQN + + E ++ Sbjct: 77 RRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNCLIDKLNRVSETQNCV-LKENSKL 135 Query: 80 SEEAKSRAHL-----SNLNSHLSDFERLFE 104 EEA L SN N++ + F R FE Sbjct: 136 KEEASDLRQLVCELKSNKNNN-NSFPREFE 164 >At1g64320.1 68414.m07289 myosin heavy chain-related similar to myosin heavy chain (GI:4249703) [Rana catesbeiana]; similar to smooth muscle myosin heavy chain SM2 (GI:2352945) [Homo sapiens] Length = 476 Score = 26.6 bits (56), Expect = 3.7 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 25 KEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAK 84 K++ KL K + E LKS E E + E+I Q + + M+ RISE Sbjct: 112 KDESEAKLEKKVEEVTETKMQLKSLKEETEEERNRLSEEIDQLKGENQMLH-RRISELDS 170 Query: 85 SRAHLSNLNSH 95 + ++H Sbjct: 171 LHMEMKTKSAH 181 Score = 25.4 bits (53), Expect = 8.6 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 4/54 (7%) Query: 47 KSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 KSEVE L +LE + Q + + ++S +E +++EE + L+ + LS FE Sbjct: 370 KSEVETLTAKLECSEAQETLLKEKLSKLE-KKLAEEGTEKLKLAKV---LSKFE 419 >At1g36160.1 68414.m04495 acetyl-CoA carboxylase 1 (ACC1) nearly identical to acetyl-CoA carboxylase 1 (ACC1) [Arabidopsis thaliana] GI:11869927 Length = 2247 Score = 26.6 bits (56), Expect = 3.7 Identities = 11/54 (20%), Positives = 31/54 (57%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKE 62 D V++ + +++ + ++++ + + LLE +G L ++ L+ +L+D K+ Sbjct: 2010 DYVEMYADETARGNVLEPEGTIEIKFRTKELLECMGRLDQKLISLKAKLQDAKQ 2063 >At1g32530.1 68414.m04014 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger); weak similarity to interaptin (GI:3549261) [Dictyostelium discoideum] weak similarity to Axoneme-associated protein mst101(2) (Swiss-Prot:Q08696) [Drosophila hydei] Length = 711 Score = 26.6 bits (56), Expect = 3.7 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 1/89 (1%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISM 73 K K K+ + EK++LKL+++ A E++ +L + + E ++++ + Q Q + Sbjct: 493 KEKKCLKKLVAWEKQILKLQDEITAEKEKIKALYKTLAQITEYEKEIEAKWRQEQ-KAKE 551 Query: 74 IEICRISEEAKSRAHLSNLNSHLSDFERL 102 + ++ EE +S+ N + RL Sbjct: 552 EALAQMEEEQRSKEAAEGHNKRKLETLRL 580 >At1g32330.1 68414.m03983 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 485 Score = 26.6 bits (56), Expect = 3.7 Identities = 11/45 (24%), Positives = 27/45 (60%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 E+EV +L+ + L++EL L+ + + +L+ M +++ +N+ Sbjct: 162 EEEVERLKRDKNVLMQELVRLRQQQQSTDNQLQTMVQRLQGMENR 206 >At1g22882.1 68414.m02857 expressed protein Length = 660 Score = 26.6 bits (56), Expect = 3.7 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 10/68 (14%) Query: 15 FKSVNKRKIMKEKEVLKLR-----NKER-----ALLEELGSLKSEVEYLRERLEDMKEQI 64 FK +++ ++EK ++ LR KER + EE+ + VE E+ E KE I Sbjct: 532 FKEMDREAGVREKAIVALRLDLEGMKERQEGMVSEAEEMKEWRKRVEAEMEKAEKEKENI 591 Query: 65 SQTQNQIS 72 Q+ Q+S Sbjct: 592 RQSLEQVS 599 >At1g14010.1 68414.m01654 emp24/gp25L/p24 family protein similar to SP|P49755 Transmembrane protein Tmp21 precursor (21 kDa Transmembrane trafficking protein) {Homo sapiens}; contains Pfam profile PF01105: emp24/gp25L/p24 family Length = 212 Score = 26.6 bits (56), Expect = 3.7 Identities = 12/58 (20%), Positives = 30/58 (51%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRIS 80 + K+ +V + + + L E + + E+ YLR+R E+M T ++++ + ++ Sbjct: 132 VAKKSQVETMEFEVKKLFETVNGIHDEMFYLRDREEEMHNLNIATNSKMAWLSFVSLA 189 >At1g01050.1 68414.m00005 inorganic pyrophosphatase, putative [soluble] / pyrophosphate phospho-hydrolase, putative / PPase, putative strong similarity to SP|Q43187 Soluble inorganic pyrophosphatase (EC 3.6.1.1) (Pyrophosphate phospho- hydrolase) (PPase) {Solanum tuberosum}; contains Pfam profile PF00719: inorganic pyrophosphatase Length = 212 Score = 26.6 bits (56), Expect = 3.7 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Query: 52 YLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSH-LSDFERLFE 104 +LR R + I Q + +I +C E K + L H LS+ R FE Sbjct: 117 FLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFE 170 >At5g66700.1 68418.m08408 homeobox-leucine zipper family protein similar to Homeobox-leucine zipper protein HAT5 (HD-ZIP protein 5) (SP:Q02283) [Arabidopsis thaliana]; contains Pfam PF00046: Homeobox domain Length = 228 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 31 KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 +L ++ L E+L +SE+ L ERLE+M S + Sbjct: 148 QLESQILKLTEQLSEAQSEIRKLSERLEEMPTNSSSS 184 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSL---KSEVEYLRERLEDMKEQISQ 66 + +N++ M E E +LR + L + L SL + V+ ++LE +K + S+ Sbjct: 469 EDINRKTTMLEDEKERLRKLDLELQQSLTSLEDKRKRVDSATQKLEALKSETSE 522 >At5g65685.1 68418.m08268 soluble glycogen synthase-related contains weak similarity to Soluble glycogen synthase, chloroplast precursor (EC 2.4.1.11) (SS III) (Swiss-Prot:Q43846) [Solanum tuberosum] Length = 460 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 +K ++ L + A ++EL LK + E L ER+ ++ + Sbjct: 75 QKNIMILNKQRLAAVDELEQLKKDKEELLERINQLEAE 112 >At5g27630.1 68418.m03310 acyl-CoA binding family protein similar to RING finger rngB protein, cytosolic - Dictyostelium discoideum, PIR:S68824; contains Pfam profiles PF01344: Kelch motif, PF00887: Acyl CoA binding protein (ACBP) Length = 648 Score = 26.2 bits (55), Expect = 4.9 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Query: 6 EKLDLVKLK--FKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMK 61 EK+ ++LK ++ R KE+ +RN+ A L+ EV LR++L+ M+ Sbjct: 546 EKIQTLQLKEELAEIDTRNTELYKELQSVRNQLAAEQSRCFKLEVEVAELRQKLQTME 603 >At5g15690.1 68418.m01835 hypothetical protein very low similarity to MtN20 [Medicago truncatula] GI:2598591 Length = 169 Score = 26.2 bits (55), Expect = 4.9 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQ 63 CGE++ K K R+ + +K N+E +L E++ + E+ + + E Sbjct: 28 CGEEIITFTSKTKENPYRRFYRCAIAMKRENEEHLFKWVDEALLDEIKMVNEKCKRVAEN 87 Query: 64 ISQTQNQISMIEICRISEEAK 84 IS + + M+ + +++ AK Sbjct: 88 ISDLRMNV-MVNMELLNKNAK 107 >At5g03415.1 68418.m00294 DPB-1 transcription factor, putative (DPB) similar to Swiss-Prot:Q14186 transcription factor DP-1 [Homo sapiens]; contains Pfam profile PF02319: Transcription factor E2F/dimerisation partner (TDP) Length = 385 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/48 (29%), Positives = 24/48 (50%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 I K+K+ ++ R R L ++ LK+E LR R+E + + Q Sbjct: 171 ISKDKKEIQWRGLPRTSLSDIEELKNERLSLRNRIEKKTAYSQELEEQ 218 >At4g31110.1 68417.m04415 wall-associated kinase, putative similar to wall-associated kinase 1, Arabidopsis thaliana, gb:AJ009696 Length = 756 Score = 26.2 bits (55), Expect = 4.9 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Query: 16 KSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 K + KR+I K K+ RN LL+EL + + VE + R+ + +E T+N Sbjct: 364 KFLIKRRITKRKKKFFKRNGGLLLLQELNTREGYVE--KTRVFNSRELEKATEN 415 >At4g27610.2 68417.m03968 expressed protein Length = 334 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 E + L+ +++ + +++M+EQI + QN + + + + +A L LN L + E Sbjct: 174 EVIQKLRQQLKRRDDMIQEMQEQILELQNSYN----AQTAHSSHLQAQLDTLNRDLFESE 229 Query: 101 R 101 R Sbjct: 230 R 230 >At4g27610.1 68417.m03967 expressed protein Length = 334 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRAHLSNLNSHLSDFE 100 E + L+ +++ + +++M+EQI + QN + + + + +A L LN L + E Sbjct: 174 EVIQKLRQQLKRRDDMIQEMQEQILELQNSYN----AQTAHSSHLQAQLDTLNRDLFESE 229 Query: 101 R 101 R Sbjct: 230 R 230 >At4g24970.1 68417.m03578 ATP-binding region, ATPase-like domain-containing protein low similarity to microrchidia [Mus musculus] GI:5410255; contains Pfam profile PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein Length = 707 Score = 26.2 bits (55), Expect = 4.9 Identities = 19/79 (24%), Positives = 36/79 (45%) Query: 27 KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSR 86 K+ +L+ + R E +L+ EV+ R+++E+MK++ S R EE R Sbjct: 618 KDGARLQEELRREKERRKALEVEVQLSRQKIEEMKKEQENLIEIFSEERDRRDGEEEVLR 677 Query: 87 AHLSNLNSHLSDFERLFEK 105 L ++ + D +K Sbjct: 678 NKLEEASNTIDDLLNKIKK 696 >At4g23800.1 68417.m03422 high mobility group (HMG1/2) family protein similar to HMG2B [Homo sapiens] GI:32335; contains Pfam profile PF00505: HMG (high mobility group) box Length = 456 Score = 26.2 bits (55), Expect = 4.9 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 8/56 (14%) Query: 10 LVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLR---ERLEDMKE 62 L K+K + +++KEK+ + LR KE EEL + +E E L+ ++L+ MKE Sbjct: 55 LEKMKIEKDKTEELLKEKDEI-LRKKE----EELETRDAEQEKLKVELKKLQKMKE 105 >At4g11420.1 68417.m01840 eukaryotic translation initiation factor 3 subunit 10 / eIF-3 theta / eIF3a (TIF3A1) identical to eukaryotic translation initiation factor 3 subunit 10 (eIF-3 theta) (Eukaryotic translation initiation factor 3 large subunit) (eIF3a) (p114). [Arabidopsis thaliana] SWISS-PROT:Q9LD55 Length = 987 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query: 8 LDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 L+ + + K K+ ++ ++V K KERAL E+L + E+E ++L + + + Sbjct: 636 LEETEKRMKKGKKKPLLDGEKVTKQSVKERALTEQLKE-RQEMEKKLQKLAKTMDYLERA 694 Query: 68 QNQ 70 + + Sbjct: 695 KRE 697 >At3g61390.2 68416.m06872 U-box domain-containing protein several hypothetical proteins - Arabidopsis thaliana Length = 435 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Query: 12 KLKFKSVNKRKIMKEK--EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 K +F++ + + K + K + E EEL K + LR+R +++++ S+++ Sbjct: 234 KARFEACKREEAEKTAVDALKKAKQWENVYFEELKQRKETEKALRKRNDELEKMRSESET 293 Query: 70 QIS 72 QI+ Sbjct: 294 QIT 296 >At3g61390.1 68416.m06871 U-box domain-containing protein several hypothetical proteins - Arabidopsis thaliana Length = 373 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Query: 12 KLKFKSVNKRKIMKEK--EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQN 69 K +F++ + + K + K + E EEL K + LR+R +++++ S+++ Sbjct: 234 KARFEACKREEAEKTAVDALKKAKQWENVYFEELKQRKETEKALRKRNDELEKMRSESET 293 Query: 70 QIS 72 QI+ Sbjct: 294 QIT 296 >At3g56270.1 68416.m06253 expressed protein contains Pfam PF05701: Plant protein of unknown function (DUF827) Length = 446 Score = 26.2 bits (55), Expect = 4.9 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 10/71 (14%) Query: 3 CCGEKLDLVKLKFKSVNKRK--IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDM 60 C GE D+ +++ ++V K IMKE E L L LE LGS K E L+ +L+ Sbjct: 69 CVGE-FDIKRMEEQTVELEKDLIMKELETLDL-------LEALGSTKRIFEDLKWQLQQQ 120 Query: 61 KEQISQTQNQI 71 + +T + Sbjct: 121 ALRCKETPQHL 131 >At3g32070.1 68416.m04077 hypothetical protein Length = 132 Score = 26.2 bits (55), Expect = 4.9 Identities = 19/83 (22%), Positives = 43/83 (51%), Gaps = 4/83 (4%) Query: 3 CCGEKLDLVKLKFKSVNKRKIMKEK-EVLKLRNK-ERALLEELGSLKSEVEYLRERLEDM 60 C G +D K + + K ++ +++ +R ++A+ EE+ SL+ V+Y R+++ Sbjct: 39 CGGSIVDTRKDEKRYYQCEKFKDDRTDLMHIRKLWDKAMEEEVSSLRESVDYNRKKVLSH 98 Query: 61 KEQISQTQNQIS--MIEICRISE 81 + I + Q ++ EI +S+ Sbjct: 99 EYLIEEMQKELKAHRAEIVNVSK 121 >At3g26125.1 68416.m03258 cytochrome P450, putative Length = 541 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Query: 22 KIMKE-KEVLKLRNKERALLEELGSLKSEVEYLRERLEDM 60 KI+ E +E+L R K + L+E G +S + + L DM Sbjct: 349 KILHEIREILNQREKNKYKLDETGEKESSRHFTVKELNDM 388 >At3g13190.2 68416.m01651 myosin heavy chain-related contains weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P05659) [Acanthamoeba castellanii] Length = 316 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 ++ E L+L+N E+A EL ++ E + +ED+K++ + Q+S++E Sbjct: 126 MLMESLKLELQNVEKAH-SELKEIEQR-ERDHQAIEDLKKETKDAKTQLSLLE 176 >At3g13190.1 68416.m01650 myosin heavy chain-related contains weak similarity to Myosin II heavy chain, non muscle (Swiss-Prot:P05659) [Acanthamoeba castellanii] Length = 316 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIE 75 ++ E L+L+N E+A EL ++ E + +ED+K++ + Q+S++E Sbjct: 126 MLMESLKLELQNVEKAH-SELKEIEQR-ERDHQAIEDLKKETKDAKTQLSLLE 176 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 26.2 bits (55), Expect = 4.9 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSE-VEYLRERLEDMKEQISQTQN 69 +LK V + + ++E E K KERA +LG + E + E +ED+ + ++ N Sbjct: 63 ELKALEVRRARALEEIEQKKEARKERAKKRKLGLVDDEDTKTEGETIEDLPKVVNVRDN 121 >At2g40840.1 68415.m05042 glycoside hydrolase family 77 protein contains Pfam profiles PF02446: 4-alpha-glucanotransferase, PF00686: Starch binding domain; contains a non-consensus AT-AC intron between at intron 5 Length = 955 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Query: 43 LGSLKSEVEYLRERL-EDMKEQISQTQNQISMIEI 76 L L V+ L ERL ED+KE+I + +NQ+ ++ Sbjct: 337 LHPLYLRVQALSERLPEDIKEEIQKAKNQLDKNDV 371 >At2g28260.1 68415.m03430 cyclic nucleotide-regulated ion channel, putative (CNGC15) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 678 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 11 VKLKFK----SVNKRKIMKEKEVLKLRNKERALLEELGSLKSEV 50 VKLKFK +N K+M + + LK + R E+L +K+++ Sbjct: 25 VKLKFKINGTQINNVKMMSKGKFLKAKVLSRVFSEDLERVKTKI 68 >At2g19410.1 68415.m02264 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 801 Score = 26.2 bits (55), Expect = 4.9 Identities = 12/52 (23%), Positives = 30/52 (57%) Query: 33 RNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAK 84 ++K+ + EE+ LK+E++ + + E++ TQN++ M+ ++E + Sbjct: 305 KSKKVEIEEEVERLKNELQSTVFKYKQACEELFSTQNKVKMLSTEYLNESKR 356 >At1g78430.1 68414.m09139 tropomyosin-related similar to Tropomyosin 1 [Baker's yeast](SP:P17536) {Saccharomyces cerevisiae}; similar to enterophilin-2L (GI:12718845) [Cavia porcellus]; similar to latent nuclear antigen (GI:5669894) [Human herpesvirus 8]; similar to multiple ligand-binding protein 1 (GI:1403575) [Streptococcus sp.] Length = 326 Score = 26.2 bits (55), Expect = 4.9 Identities = 14/62 (22%), Positives = 30/62 (48%) Query: 1 MSCCGEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDM 60 MSC K D + K + + + KL+ K ++ E +L++E++ L+ + E Sbjct: 196 MSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLEAEMKKLKVQTEQW 255 Query: 61 KE 62 ++ Sbjct: 256 RK 257 >At1g68790.1 68414.m07863 expressed protein Length = 1085 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/39 (28%), Positives = 24/39 (61%) Query: 30 LKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 ++L R+L EEL K+E+E L+ + +E++++ + Sbjct: 369 MELEQMRRSLDEELEGKKAEIEQLQVEISHKEEKLAKRE 407 >At1g65070.1 68414.m07377 DNA mismatch repair MutS family protein contains Pfam profile PF00488: MutS domain V Length = 857 Score = 26.2 bits (55), Expect = 4.9 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 9 DLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQ 68 DL+ L + ++ + ++E L+ + + + E+L S KS++E L E E I+Q Sbjct: 618 DLMNLYHELEHESHDLDKRERALLKKETQKVQEDLNSAKSKMERLVAEFESQLE-ITQAD 676 Query: 69 NQISMI 74 S+I Sbjct: 677 QYNSLI 682 >At1g58400.1 68414.m06644 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 900 Score = 26.2 bits (55), Expect = 4.9 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Query: 34 NKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSRA 87 N ++ L++ + K+ + +R +E++KE + T+N MIE + E A+ R+ Sbjct: 39 NLLKSFLKDAEAKKNTSQMVRHCVEEIKEIVYDTEN---MIETFILKEAARKRS 89 >At1g45976.1 68414.m05206 expressed protein Length = 325 Score = 26.2 bits (55), Expect = 4.9 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 5/69 (7%) Query: 10 LVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERL----EDMKEQIS 65 L K+K +M+EK V KLR K+ LE + E+E E+L E +++ Sbjct: 166 LDKIKRGQQKTVSLMEEKVVQKLREKDEE-LERINRKNKELEVRMEQLTMEAEAWQQRAK 224 Query: 66 QTQNQISMI 74 +N I+ + Sbjct: 225 YNENMIAAL 233 >At1g21900.1 68414.m02741 emp24/gp25L/p24 family protein similar to SP|O35587 Transmembrane protein Tmp21 precursor (21 kDa Transmembrane trafficking protein) {Mesocricetus auratus}; contains Pfam profile PF01105: emp24/gp25L/p24 family Length = 216 Score = 26.2 bits (55), Expect = 4.9 Identities = 17/70 (24%), Positives = 38/70 (54%), Gaps = 5/70 (7%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 K+ + + SV K++ ++ E L+LR E +L S++ + Y+++R +M+E Sbjct: 125 KMGIAAKDWDSVAKKEKIEGVE-LQLRRLEGLVL----SIRENLNYIKDREAEMREVSET 179 Query: 67 TQNQISMIEI 76 T ++++ I Sbjct: 180 TNSRVAWFSI 189 >At1g12430.1 68414.m01436 armadillo/beta-catenin repeat family protein / kinesin motor family protein Length = 919 Score = 26.2 bits (55), Expect = 4.9 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 1/93 (1%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 E +L KL K K+ E+EV +L+++ + S SE+ L + LE+ +Q Sbjct: 533 EVSELKKLLQKEAQS-KMAAEEEVNRLKHQLNEFKKVEASGNSEIMRLHKMLENETQQKE 591 Query: 66 QTQNQISMIEICRISEEAKSRAHLSNLNSHLSD 98 + + +I+ + + + NL H S+ Sbjct: 592 KLEGEIATLHSQLLQLSLTADETRRNLEQHGSE 624 >At1g09760.1 68414.m01095 U2 small nuclear ribonucleoprotein A, putative identical to U2 small nuclear ribonucleoprotein A' (U2 snRNP-A') [Arabidopsis thaliana] SWISS-PROT:P43333; supported by cDNA:gi_16649064_gb_AY059902.1_ Length = 249 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/50 (26%), Positives = 29/50 (58%) Query: 18 VNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQT 67 ++K K ++ + +K++ KERA L S K E +++ + +++S+T Sbjct: 136 IHKLKSLRVLDFIKIKAKERAEAASLFSSKEAEEEVKKVSREEVKKVSET 185 >At1g04600.1 68414.m00454 myosin, putative similar to myosin (GI:499047) [Arabidopsis thaliana] Length = 1730 Score = 26.2 bits (55), Expect = 4.9 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Query: 11 VKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 +KL+ + + K + ++ + +EEL L E +KE +S QN+ Sbjct: 957 IKLQLRDTQETKSKEISDLQSALQDMQLEIEELSKGLEMTNDLAAENEQLKESVSSLQNK 1016 Query: 71 I-----SMIEICRISEE 82 I EI +ISEE Sbjct: 1017 IDESERKYEEISKISEE 1033 >At5g54680.1 68418.m06809 basic helix-loop-helix (bHLH) family protein similar to unknown protein (pir |B71406) Length = 234 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/44 (25%), Positives = 25/44 (56%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 E KL++ +L +++ LK+E LR+ + +K + + + Q+ Sbjct: 125 EAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL 168 >At5g54110.1 68418.m06737 vesicle-associated membrane family protein / VAMP family protein similar to VAP27 GI:6688926 [Nicotiana plumbaginifolia] Length = 266 Score = 25.8 bits (54), Expect = 6.5 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 6/79 (7%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 EK+ L ++K + + L +K VEY+ E ++ K+Q++ Q ++ + I + S Sbjct: 151 EKQPLNQKSKVKFKIMSL-KVKPGVEYVPELFDEQKDQVAVEQ----VLRVIFIDADRPS 205 Query: 86 RAHLSNLNSHLSDFERLFE 104 A L L L + E E Sbjct: 206 AA-LEKLKRQLDEAEAAVE 223 >At5g54070.1 68418.m06731 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 331 Score = 25.8 bits (54), Expect = 6.5 Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 4/88 (4%) Query: 21 RKIMKEKEVLKLRNKERALLE---ELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEIC 77 + I + + K NKE + E+ SLK E +R + +K+Q ++Q+Q+ ++ Sbjct: 156 KNIKRRSKNTKCCNKEASTTTTETEVESLKEEQSPMRLEMLKLKQQQEESQHQMVTVQE- 214 Query: 78 RISEEAKSRAHLSNLNSHLSDFERLFEK 105 +I + H+ + + L+ +R E+ Sbjct: 215 KIHGVDTEQQHMLSFFAKLAKDQRFVER 242 >At5g20580.2 68418.m02444 expressed protein predicted protein, Arabidopsis thaliana Length = 348 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICR---ISEEAKSRAHLSNLNSHLS 97 +EL +L +EV+ L L + IS+ +I + ++E + RA L + + Sbjct: 259 QELRTLSAEVDQLHSELNLARSLISERDREIQHVRNTNNQYVAENERLRAILGEWSMRAA 318 Query: 98 DFERLFE 104 ER E Sbjct: 319 KLERALE 325 >At5g20580.1 68418.m02443 expressed protein predicted protein, Arabidopsis thaliana Length = 348 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Query: 41 EELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICR---ISEEAKSRAHLSNLNSHLS 97 +EL +L +EV+ L L + IS+ +I + ++E + RA L + + Sbjct: 259 QELRTLSAEVDQLHSELNLARSLISERDREIQHVRNTNNQYVAENERLRAILGEWSMRAA 318 Query: 98 DFERLFE 104 ER E Sbjct: 319 KLERALE 325 >At5g19900.1 68418.m02368 PRLI-interacting factor, putative strong similarity to PRLI-interacting factor A [Arabidopsis thaliana] GI:11139262 Length = 494 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/48 (25%), Positives = 27/48 (56%), Gaps = 3/48 (6%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRER---LEDMKEQISQTQNQ 70 E+E L L+ + + ELG ++ ++YL R +D E++ + +++ Sbjct: 323 EEENLTLKERLFLMERELGDMRRRLQYLERRDMVAQDANEEVVENESE 370 >At5g12900.1 68418.m01480 expressed protein Length = 562 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/86 (19%), Positives = 39/86 (45%), Gaps = 3/86 (3%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI-SMIEICRISEEAK 84 ++E+++ A L ++ +KS + L E+L+ ++ + + E+ +S+E Sbjct: 252 KRELMEANRSRDAALTQVSEMKSSLGELSEKLQYLESYCDNLKKALREATEV--VSQENS 309 Query: 85 SRAHLSNLNSHLSDFERLFEKGFILI 110 NS + E + +GF+ I Sbjct: 310 GGRSSGKKNSEMPVSEEVMVEGFLQI 335 >At5g03720.1 68418.m00332 heat shock transcription factor family protein contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 412 Score = 25.8 bits (54), Expect = 6.5 Identities = 10/43 (23%), Positives = 24/43 (55%) Query: 28 EVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 E+ KLR + RAL+EE+ L+ + ++ + +++ + + Sbjct: 171 EIEKLRKERRALMEEMVELQQQSRGTARHVDTVNQRLKAAEQR 213 >At4g17010.1 68417.m02566 expressed protein Length = 160 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/71 (23%), Positives = 38/71 (53%), Gaps = 2/71 (2%) Query: 7 KLDLVKLKFKSVNKRKIMKEKEVLKLRNKE-RALLEELGSLKSEVEYLRERLEDMKEQIS 65 +L L K + + N+RK+ + ++ E R ++EE+ +L ++E ++ED + I Sbjct: 30 RLQLEK-RIQQANQRKVEINRLPEQIVLSEVRRMVEEMQNLNKQIENTEAQIEDYFKPID 88 Query: 66 QTQNQISMIEI 76 + + I I++ Sbjct: 89 KHASTIMEIQL 99 >At3g52250.1 68416.m05742 myb family transcription factor contains Pfam profile: PF00249 myb-like DNA-binding domain Length = 1677 Score = 25.8 bits (54), Expect = 6.5 Identities = 18/84 (21%), Positives = 36/84 (42%) Query: 23 IMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEE 82 ++K +N +R++ ++L + L + + E S T+ S + +S + Sbjct: 1454 LLKATNTESCQNPQRSVTQDLSRISRSKSDLIVKTQRTGEGFSLTKCTSSAPKPLAVSHK 1513 Query: 83 AKSRAHLSNLNSHLSDFERLFEKG 106 H + + LSD ERL + G Sbjct: 1514 EGRSGHSRSHSFSLSDTERLHKNG 1537 >At3g47460.1 68416.m05161 SMC2-like condensin, putative similar to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1171 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 G DL K K++ R K++ N L+ E ++ E YL+ +L ++ QI Sbjct: 784 GRLKDLEK-NIKTLKARIQASSKDLKGHENVRERLVMEQEAVTQEQSYLKSQLTSLRTQI 842 Query: 65 SQTQNQI 71 S + + Sbjct: 843 STLASDV 849 >At3g29700.1 68416.m03744 expressed protein Length = 132 Score = 25.8 bits (54), Expect = 6.5 Identities = 13/48 (27%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 36 ERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQIS--MIEICRISE 81 ++A+ EE+ SL+ V+Y R+++ + I + Q ++ EI +S+ Sbjct: 74 DKAMEEEVSSLRESVDYNRKKVLSHEYLIEEMQKELKAHRAEIVNVSK 121 >At3g19860.1 68416.m02515 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 284 Score = 25.8 bits (54), Expect = 6.5 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Query: 22 KIMKE--KEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQ 70 +++KE EV KL+++ AL +E L E LRE +K I Q Sbjct: 50 QLLKELTSEVNKLKSEYTALTDESRELTQEKNDLREEKTSLKSDIENLNLQ 100 >At3g04850.1 68416.m00526 tesmin/TSO1-like CXC domain-containing protein similar to CXC domain containing TSO1-like protein 1 (SOL1) [Arabidopsis thaliana] GI:7767427, CXC domain protein TSO1 [Arabidopsis thaliana] GI:7767425; contains Pfam profile PF03638: Tesmin/TSO1-like CXC domain Length = 639 Score = 25.8 bits (54), Expect = 6.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 4 CGEKLDLVKLKFKSVNKRKIMKEKEVLKLRN 34 CGE K +++ +MK +EV+K RN Sbjct: 476 CGEPCSCQNCFNKPIHEDLVMKSREVIKARN 506 >At2g38040.2 68415.m04670 acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit family contains Pfam profile: PF03255: Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit Length = 769 Score = 25.8 bits (54), Expect = 6.5 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 11/97 (11%) Query: 20 KRKIMKEKEV-LKLRNKERALLEELGSLKSEV--EY--------LRERLEDMKEQISQTQ 68 K +I+K KE + L E + LKSE+ EY L ERL M+E+ S+ Sbjct: 443 KEQILKAKETSTEAEPSSEVLNEMIEKLKSEIDDEYTEAAIAVGLEERLTAMREEFSKAS 502 Query: 69 NQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 ++ ++ I + K + + + ++E L K Sbjct: 503 SEEHLMHPVLIEKIEKLKEEFNTRLTDAPNYESLKSK 539 >At2g38040.1 68415.m04669 acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit family contains Pfam profile: PF03255: Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit Length = 769 Score = 25.8 bits (54), Expect = 6.5 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 11/97 (11%) Query: 20 KRKIMKEKEV-LKLRNKERALLEELGSLKSEV--EY--------LRERLEDMKEQISQTQ 68 K +I+K KE + L E + LKSE+ EY L ERL M+E+ S+ Sbjct: 443 KEQILKAKETSTEAEPSSEVLNEMIEKLKSEIDDEYTEAAIAVGLEERLTAMREEFSKAS 502 Query: 69 NQISMIEICRISEEAKSRAHLSNLNSHLSDFERLFEK 105 ++ ++ I + K + + + ++E L K Sbjct: 503 SEEHLMHPVLIEKIEKLKEEFNTRLTDAPNYESLKSK 539 >At2g37420.1 68415.m04589 kinesin motor protein-related Length = 1039 Score = 25.8 bits (54), Expect = 6.5 Identities = 13/60 (21%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Query: 9 DLVKLKFKSVNKRKIMKEKEVL--KLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQ 66 DL+ LK + +KEKEV+ +++ E +L++ L+ ++++ + + ++ Q Sbjct: 498 DLLDLKENYIQVVSKLKEKEVIVSRMKASETSLIDRAKGLRCDLQHASNDINSLFTRLDQ 557 >At2g18760.1 68415.m02184 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|Q03468 Excision repair protein ERCC-6 (Cockayne syndrome protein CSB) {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1187 Score = 25.8 bits (54), Expect = 6.5 Identities = 21/98 (21%), Positives = 44/98 (44%), Gaps = 3/98 (3%) Query: 14 KFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLE-DMKEQISQTQNQIS 72 + +S+ KRKI EKE+ L + + + G+L ++ + L+ +KE ++ Sbjct: 118 RLRSLKKRKIQLEKELTGLHGQSASSSADHGNLLRDLVKEKPSLKRKLKEIRKPSRRDGK 177 Query: 73 MIEICRISEEAKSRAHLSNLNSHLSDFER--LFEKGFI 108 +++ E+ A ++ + ER L KG + Sbjct: 178 KVKVVSFREDTDFDAVFDGASAGFVETERDELVRKGIL 215 >At2g05410.1 68415.m00569 ubiquitin-specific protease-related / meprin and TRAF homology (MATH) domain-containing protein-related similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; supported by tandem duplication of meprin and TRAF homology (MATH) domain protein (GI:4914358) (TIGR_Ath1:At2g05420) [Arabidopsis thaliana] Length = 265 Score = 25.8 bits (54), Expect = 6.5 Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 4/71 (5%) Query: 5 GEKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 G KLD ++ K + ++K +E +++LR + E+L K + +++ KE++ Sbjct: 193 GLKLDWLEKKLDELKEKKKKEESCLVRLREMD----EQLQPFKKRCLDIEDQISKEKEEL 248 Query: 65 SQTQNQISMIE 75 + +S+ + Sbjct: 249 LAAREPLSLYD 259 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 25.8 bits (54), Expect = 6.5 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQI 71 KLK K + +K +L+ +NK L +EL + K ++ +RL+D ++ + Q++ Sbjct: 1390 KLKAKDAHAEDC--KKVLLEKQNKISLLEKELTNCKKDLSEREKRLDDAQQAQATMQSEF 1447 Query: 72 S 72 + Sbjct: 1448 N 1448 >At1g31440.1 68414.m03850 SH3 domain-containing protein 1 (SH3P1) nearly identical to SH3 domain-containing protein 1 [Arabidopsis thaliana] GI:16974676; contains Pfam profile PF00018: SH3 domain Length = 439 Score = 25.8 bits (54), Expect = 6.5 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 7/82 (8%) Query: 13 LKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYL-RERLEDMKEQISQTQNQI 71 L+ +S K + E+ +KL+N E L E LKS ++ L +E + M E Q QN Sbjct: 170 LRRRSKLKESDISEEAYIKLKNSESRLAE----LKSSMKTLGKEATKAMLEVDDQQQNVT 225 Query: 72 SMIEICRISEEAKSRAHLSNLN 93 S + R EA+ H + L+ Sbjct: 226 S--QRLRALVEAERSYHRNALD 245 >At1g22060.1 68414.m02759 expressed protein Length = 1999 Score = 25.8 bits (54), Expect = 6.5 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Query: 32 LRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKSR-AHLS 90 LRN +EEL S E L E + K Q+ + ++ +E SE++ R ++ Sbjct: 1282 LRNNLDRRVEELTSELDEKHLLLENFDLQKSQVELLEKMVAELE----SEKSFQRLEYVR 1337 Query: 91 NLNSHLSDFERLFE 104 N + S E LF+ Sbjct: 1338 NAHRESSFIEELFQ 1351 >At1g03970.1 68414.m00383 G-box binding factor 4 (GBF4) identical to G-box binding factor 4 (GBF4) SP:P42777 from [Arabidopsis thaliana] Length = 270 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/53 (22%), Positives = 28/53 (52%) Query: 12 KLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 ++ ++++K ++K ++K R E + + E+E L +LE+ EQ+ Sbjct: 177 RVMMEAMDKAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQL 229 >At5g16820.2 68418.m01971 heat shock factor protein 3 (HSF3) / heat shock transcription factor 3 (HSTF3) identical to heat shock transcription factor 3 (HSF3) SP:O81821 from [Arabidopsis thaliana] Length = 481 Score = 25.4 bits (53), Expect = 8.6 Identities = 14/67 (20%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 E+EV +L+ + L++EL L+ + + +L+++ +++ Q Q + +++ +S Sbjct: 148 EEEVERLKRDKNVLMQELVRLRQQQQATENQLQNVGQKV-QVMEQRQQQMMSFLAKAVQS 206 Query: 86 RAHLSNL 92 L+ L Sbjct: 207 PGFLNQL 213 >At5g16820.1 68418.m01970 heat shock factor protein 3 (HSF3) / heat shock transcription factor 3 (HSTF3) identical to heat shock transcription factor 3 (HSF3) SP:O81821 from [Arabidopsis thaliana] Length = 481 Score = 25.4 bits (53), Expect = 8.6 Identities = 14/67 (20%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Query: 26 EKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQISQTQNQISMIEICRISEEAKS 85 E+EV +L+ + L++EL L+ + + +L+++ +++ Q Q + +++ +S Sbjct: 148 EEEVERLKRDKNVLMQELVRLRQQQQATENQLQNVGQKV-QVMEQRQQQMMSFLAKAVQS 206 Query: 86 RAHLSNL 92 L+ L Sbjct: 207 PGFLNQL 213 >At5g10470.1 68418.m01213 kinesin motor protein-related TH65 protein, Arabidopsis thaliana, EMBL:AJ001729; contains Pfam profile PF00225: Kinesin motor domain Length = 1273 Score = 25.4 bits (53), Expect = 8.6 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 12/101 (11%) Query: 7 KLDLVKLK--FKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQI 64 K ++V LK K N + ++ EV + L +L KSE L ++ KEQ Sbjct: 491 KQEVVGLKKALKDANDQCVLLYSEVQRAWKVSFTLQSDL---KSENIMLVDKHRLEKEQN 547 Query: 65 SQTQNQISMIEICRISEEAKSR-----AHLSNLNSHLSDFE 100 SQ +NQI+ + ++ +E K + + + NL + ++D E Sbjct: 548 SQLRNQIA--QFLQLDQEQKLQMQQQDSAIQNLQAKITDLE 586 >At4g37080.2 68417.m05252 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 610 Score = 25.4 bits (53), Expect = 8.6 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 +K+DL++ K KRK+ +E+ V R ERA LG+L YL ++ +++ Sbjct: 55 KKMDLLQDVDKL--KRKLRQEENVH--RALERAFTRPLGALPRLPSYLPRHTLELLAEVA 110 Query: 66 QTQNQISMIE 75 + ++ +E Sbjct: 111 VLEEEVVRLE 120 >At4g37080.1 68417.m05253 expressed protein contains Pfam profile PF04784: Protein of unknown function, DUF547 Length = 597 Score = 25.4 bits (53), Expect = 8.6 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (5%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEELGSLKSEVEYLRERLEDMKEQIS 65 +K+DL++ K KRK+ +E+ V R ERA LG+L YL ++ +++ Sbjct: 42 KKMDLLQDVDKL--KRKLRQEENVH--RALERAFTRPLGALPRLPSYLPRHTLELLAEVA 97 Query: 66 QTQNQISMIE 75 + ++ +E Sbjct: 98 VLEEEVVRLE 107 >At4g35985.1 68417.m05121 senescence/dehydration-associated protein-related similar to senescence-associated protein 12 [Hemerocallis hybrid cultivar] gi|3551958|gb|AAC34857; similar to early-responsive to dehydration stress ERD7 protein [Arabidopsis thaliana] gi|15320412|dbj|BAB63916 Length = 448 Score = 25.4 bits (53), Expect = 8.6 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 6 EKLDLVKLKFKSVNKRKIMKEKEVLKLRNKERALLEEL-GSLKSEVE 51 EKLD + + S + KE+ VL L + EEL G K VE Sbjct: 177 EKLDKILADYSSFTAEEKQKEENVLDLTAAKETSPEELKGKRKKMVE 223 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.132 0.350 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,321,247 Number of Sequences: 28952 Number of extensions: 82886 Number of successful extensions: 1241 Number of sequences better than 10.0: 271 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 128 Number of HSP's that attempted gapping in prelim test: 907 Number of HSP's gapped (non-prelim): 457 length of query: 111 length of database: 12,070,560 effective HSP length: 72 effective length of query: 39 effective length of database: 9,986,016 effective search space: 389454624 effective search space used: 389454624 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -