BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001951-TA|BGIBMGA001951-PA|IPR001810|Cyclin-like F-box, IPR000608|Ubiquitin-conjugating enzyme, E2 (430 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) 82 1e-15 SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) 62 1e-09 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 61 1e-09 SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) 51 2e-06 SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) 50 3e-06 SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 8e-06 SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) 46 6e-05 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_46499| Best HMM Match : F-box (HMM E-Value=1.2e-11) 44 2e-04 SB_6560| Best HMM Match : F-box (HMM E-Value=2e-10) 42 0.001 SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) 42 0.001 SB_10280| Best HMM Match : F-box (HMM E-Value=5.2e-09) 39 0.007 SB_4015| Best HMM Match : F-box (HMM E-Value=5.9e-11) 39 0.009 SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) 38 0.021 SB_41663| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.036 SB_41994| Best HMM Match : F-box (HMM E-Value=1.4e-06) 36 0.048 SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) 34 0.19 SB_43663| Best HMM Match : F-box (HMM E-Value=4e-07) 33 0.45 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_50716| Best HMM Match : WD40 (HMM E-Value=0) 32 1.0 SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 1.0 SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) 31 1.8 SB_9425| Best HMM Match : F-box (HMM E-Value=1.1e-11) 30 3.2 SB_43342| Best HMM Match : F-box (HMM E-Value=4.1e-09) 30 4.2 SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_20396| Best HMM Match : SEC-C (HMM E-Value=1.5) 29 5.5 SB_31644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_18737| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_41941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.6 SB_25767| Best HMM Match : F-box (HMM E-Value=9.7e-09) 29 9.6 SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24) 29 9.6 >SB_33407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 226 Score = 81.8 bits (193), Expect = 1e-15 Identities = 51/142 (35%), Positives = 74/142 (52%), Gaps = 15/142 (10%) Query: 282 RLRIELKMLRNDPPEGIAATPLDPKCCHWQASVTGPVGSPYEGGVFYLYIQXXXXXXXXX 341 R++ EL + DPP +A P W +++ GP GS YEGGVF+L I Sbjct: 99 RIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDIHFPSD----- 153 Query: 342 XXXRFLTRILHPNVSRHGDVGIDSVHHNWSLALTLSKVLISIQSLLTDPYTAVCMEPELG 401 +P G V +D + +WS ALT+SKVL+SI SLLTD A + + Sbjct: 154 ----------YPFKPPKGMVCLDILKDSWSPALTISKVLLSICSLLTDCNPADPLVGSIA 203 Query: 402 EMYVRDRARFESLARRWTWRYA 423 +YV++R+ ++ A+ WT RYA Sbjct: 204 ALYVQNRSEHDATAKEWTKRYA 225 >SB_44322| Best HMM Match : UQ_con (HMM E-Value=1.6e-37) Length = 190 Score = 61.7 bits (143), Expect = 1e-09 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 4/119 (3%) Query: 316 GPVGSPYEGGVFYLYIQXXXXXXXXXXXXRFLTRILHPNVSRHGDVGIDSVHHN----WS 371 G G+PY G+F L IQ RF+T I HPN+ G + +D++ W Sbjct: 4 GAEGTPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWK 63 Query: 372 LALTLSKVLISIQSLLTDPYTAVCMEPELGEMYVRDRARFESLARRWTWRYAMHDILIN 430 AL +S VL +I L+ +P + E+ + ++A+F A+ WT ++AM L N Sbjct: 64 PALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQFLEKAKEWTLKFAMDPSLEN 122 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 61.3 bits (142), Expect = 1e-09 Identities = 37/124 (29%), Positives = 56/124 (45%), Gaps = 14/124 (11%) Query: 283 LRIELKMLRNDPPEGIAA-TPLDPKCCHWQASVTGPVGSPYEGGVFYLYIQXXXXXXXXX 341 L++ELK L +P EG P + W ++ GP G+ Y GG F ++ Sbjct: 1129 LQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDYPYSP 1188 Query: 342 XXXRFLTRILHPNVSRHGDVGIDSVH-------------HNWSLALTLSKVLISIQSLLT 388 RFLT++ HPN+ GDV I +H W+ + +L+S+ SLL Sbjct: 1189 PTFRFLTKMWHPNIYESGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLN 1248 Query: 389 DPYT 392 +P T Sbjct: 1249 EPNT 1252 >SB_28696| Best HMM Match : UQ_con (HMM E-Value=5.3e-30) Length = 204 Score = 50.8 bits (116), Expect = 2e-06 Identities = 42/156 (26%), Positives = 69/156 (44%), Gaps = 26/156 (16%) Query: 279 RRNRLRIELKMLRNDPPEGIAATPLDPKCCHWQASVTGPVGSPYEGGVFYLYIQXXXXXX 338 R R++ EL++L DPP G + P+D + T P+E Sbjct: 3 RNARMKRELRLLAEDPPHGASCWPVDENRIDKLEAST-----PFEPP------------- 44 Query: 339 XXXXXXRFLTRILHPNVSRHGDVGIDSVHHN----WSLALTLSKVLISIQSLLTDPYTAV 394 RF+T I HPN+ G + +D++ W AL +S VL +I L+ +P Sbjct: 45 ----KVRFVTPIYHPNIDSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDD 100 Query: 395 CMEPELGEMYVRDRARFESLARRWTWRYAMHDILIN 430 + E+ + ++A+F A+ WT ++AM L N Sbjct: 101 PLMAEISNEFKYNKAQFLEKAKEWTLKFAMDPSLEN 136 >SB_15708| Best HMM Match : UQ_con (HMM E-Value=0) Length = 145 Score = 50.4 bits (115), Expect = 3e-06 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 2/115 (1%) Query: 309 HWQASVTGPVGSPYEGGVFYLYIQXXXXXXXXXXXXRFLTRILHPNVSRHGDVGIDSVH- 367 +WQ + P PY G F + I F T+I HPN+ G V + + Sbjct: 25 YWQGLIV-PEMPPYNKGAFRIEICFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPIISP 83 Query: 368 HNWSLALTLSKVLISIQSLLTDPYTAVCMEPELGEMYVRDRARFESLARRWTWRY 422 NW A +V+ ++ +L+ DP + +L E Y +D+ +F A T +Y Sbjct: 84 ENWKPATKTEQVIQALLALVHDPEPEHPLRADLAEEYSKDKKKFMKNAEDCTKKY 138 >SB_21041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 48.8 bits (111), Expect = 8e-06 Identities = 20/74 (27%), Positives = 44/74 (59%) Query: 346 FLTRILHPNVSRHGDVGIDSVHHNWSLALTLSKVLISIQSLLTDPYTAVCMEPELGEMYV 405 FLT+I HPNV+++G++ ++++ +W L + +VL++++ LL P + E G++ + Sbjct: 147 FLTKIFHPNVAKNGEICVNTLKKDWKPDLGIKQVLLTVKCLLIVPNPESALNEEAGKLLL 206 Query: 406 RDRARFESLARRWT 419 + A+ +T Sbjct: 207 ERYDDYSKRAKMFT 220 >SB_7202| Best HMM Match : UQ_con (HMM E-Value=5.9e-05) Length = 200 Score = 46.0 bits (104), Expect = 6e-05 Identities = 21/50 (42%), Positives = 29/50 (58%) Query: 282 RLRIELKMLRNDPPEGIAATPLDPKCCHWQASVTGPVGSPYEGGVFYLYI 331 R++ EL + DPP +A P W +++ GP GS YEGGVF+L I Sbjct: 139 RIQRELTEITLDPPPNCSAGPKGDDLYEWYSTILGPPGSVYEGGVFFLDI 188 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 44.8 bits (101), Expect = 1e-04 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 14/115 (12%) Query: 290 LRNDPPEGIAATPLDPKCCH-WQASVTGPVGSPYEGGVFYLYIQXXXXXXXXXXXXRFLT 348 L+ P EG +A D + + W+ V GP G+ YE G F + F++ Sbjct: 344 LQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFIS 403 Query: 349 RILHPNVSRHGDVGIDSVH-------------HNWSLALTLSKVLISIQSLLTDP 390 I HPNV ++G+V I +H W T+ +++S+ S+L +P Sbjct: 404 DIWHPNVHKNGEVCISILHEPGEDKYGYEKADERWRPIHTVETIMLSVISMLAEP 458 >SB_46499| Best HMM Match : F-box (HMM E-Value=1.2e-11) Length = 335 Score = 44.4 bits (100), Expect = 2e-04 Identities = 23/55 (41%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 181 LVEHLPSEVLLCIFSYLDDLSLCACSCVCTRWWRLVRARVCPGRWEDFAAARWPL 235 L+ P V+L IF YLD +LCA S VC RW+ L + R W+ WPL Sbjct: 25 LICSFPDNVMLNIFRYLDIKALCAASKVCRRWYHLGKDR---SLWKAVDLRPWPL 76 >SB_6560| Best HMM Match : F-box (HMM E-Value=2e-10) Length = 216 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/34 (52%), Positives = 26/34 (76%) Query: 182 VEHLPSEVLLCIFSYLDDLSLCACSCVCTRWWRL 215 +E L ++VLL IFS+LD SLC+CS VC +W+ + Sbjct: 1 MEILGTDVLLHIFSHLDAQSLCSCSQVCKQWYEV 34 >SB_47222| Best HMM Match : UQ_con (HMM E-Value=5) Length = 46 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/45 (40%), Positives = 28/45 (62%) Query: 380 LISIQSLLTDPYTAVCMEPELGEMYVRDRARFESLARRWTWRYAM 424 L+SI SLL DP + P++ +Y D+ ++ LA+ WT +YAM Sbjct: 2 LLSICSLLCDPNPDDPLVPDIARIYKTDKPKYNELAKEWTKKYAM 46 >SB_10280| Best HMM Match : F-box (HMM E-Value=5.2e-09) Length = 438 Score = 39.1 bits (87), Expect = 0.007 Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 179 PGLVEHLPSEVLLCIFSYLDDLSLCACSCVCTRW 212 P + +LP ++LL IFSYL LC S VC +W Sbjct: 302 PSAINNLPEDLLLNIFSYLTTPELCLASGVCCKW 335 >SB_4015| Best HMM Match : F-box (HMM E-Value=5.9e-11) Length = 130 Score = 38.7 bits (86), Expect = 0.009 Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 182 VEHLPSEVLLCIFSYLDDLSLCACSCVCTRW 212 +E LP VLL +FS+L SLC + VC RW Sbjct: 26 IERLPDSVLLQVFSFLCQRSLCKLALVCKRW 56 >SB_33408| Best HMM Match : UQ_con (HMM E-Value=3.7e-07) Length = 181 Score = 37.5 bits (83), Expect = 0.021 Identities = 16/33 (48%), Positives = 21/33 (63%) Query: 299 AATPLDPKCCHWQASVTGPVGSPYEGGVFYLYI 331 +A P K W +++ GP GS YEGGVF+L I Sbjct: 43 SAGPKGDKLYEWYSTILGPPGSVYEGGVFFLDI 75 >SB_41663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 36.7 bits (81), Expect = 0.036 Identities = 16/32 (50%), Positives = 20/32 (62%) Query: 181 LVEHLPSEVLLCIFSYLDDLSLCACSCVCTRW 212 L+ +LP E+L IFSYL+ LC S VC W Sbjct: 111 LIHNLPPEILNKIFSYLNPKDLCRTSQVCKSW 142 >SB_41994| Best HMM Match : F-box (HMM E-Value=1.4e-06) Length = 1020 Score = 36.3 bits (80), Expect = 0.048 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 4/80 (5%) Query: 185 LPSEVLLCIFSYLDDLSLCACSCVCTRWWRLVRARVCPGRWEDFAAARWPL-YRPLATHT 243 + +V++ +F +LD +L + S VC RW+RL + W D A++ +P A H Sbjct: 564 IADDVIIAVFRFLDMRNLLSASLVCRRWYRLTQD---SSLWTDLDLAQYSTKLQPAAIHR 620 Query: 244 DWHKKYQSLVESCFCRNCLV 263 + + L C V Sbjct: 621 LLSQSFAPLGRRLSLATCAV 640 >SB_20853| Best HMM Match : F-box (HMM E-Value=1.1e-05) Length = 637 Score = 34.3 bits (75), Expect = 0.19 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 8/72 (11%) Query: 188 EVLLCIFSYLDDLSLCACSCVCTRWWRLVRARVCPGRWEDFAAARWPLYRPL-----ATH 242 E+LL IF Y D L VC +W + + P W RW R L + Sbjct: 7 EILLQIFRYFDAFILTKICSVCKQWNSISKT---PSLWRRLVLRRWQSQRFLFANVPPSS 63 Query: 243 TDWHKKYQSLVE 254 +W K YQ + + Sbjct: 64 VNWRKVYQEIFQ 75 >SB_43663| Best HMM Match : F-box (HMM E-Value=4e-07) Length = 717 Score = 33.1 bits (72), Expect = 0.45 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 172 RPPDNLAPGL--VEHLPSEVLLCIFSYLDDLSLCACSCVCTRWWRL 215 R PD P + LP LL +F YLD+ L + CT W R+ Sbjct: 299 RDPDTGGPSRTHIAELPESCLLRVFFYLDEAQLGRVARTCTTWRRI 344 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 32.3 bits (70), Expect = 0.78 Identities = 13/31 (41%), Positives = 20/31 (64%) Query: 185 LPSEVLLCIFSYLDDLSLCACSCVCTRWWRL 215 LP E++L IFS L L C+ VC +++R+ Sbjct: 2708 LPDEIVLKIFSSLSHKDLATCALVCQQFYRI 2738 >SB_50716| Best HMM Match : WD40 (HMM E-Value=0) Length = 494 Score = 31.9 bits (69), Expect = 1.0 Identities = 16/53 (30%), Positives = 24/53 (45%) Query: 193 IFSYLDDLSLCACSCVCTRWWRLVRARVCPGRWEDFAAARWPLYRPLATHTDW 245 I S+LD SLCA VC W R++ + + + PL+ L+ W Sbjct: 85 ILSFLDAKSLCAAEVVCKEWHRVIADGMLWKKLIERKVRTDPLWHGLSERRGW 137 >SB_5638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.9 bits (69), Expect = 1.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Query: 312 ASVTGPVGSPYEGGVFYLYIQ 332 A +TGP +PYEGG FY I+ Sbjct: 15 ALITGPFDTPYEGGFFYFLIR 35 >SB_18275| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 325 Score = 31.1 bits (67), Expect = 1.8 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 8/55 (14%) Query: 165 LHALSTPRPPDNLAPGLVEHLPSEVLLCIFSYL-----DDLSLCACSCVCTRWWR 214 LH P PDN +P L P E+ LC F D+ ++C C CTR ++ Sbjct: 237 LHDGPCPPTPDNTSPPLD---PCEITLCAFPRTKCRVKDNTAVCECPKACTREYK 288 >SB_9425| Best HMM Match : F-box (HMM E-Value=1.1e-11) Length = 376 Score = 30.3 bits (65), Expect = 3.2 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 185 LPSEVLLCIFSYLDDLSLCACSCVCTRWWRLVRARVCPGRWEDFAA 230 +P VLL I S+L+ S VC RW R+ R R DF+A Sbjct: 72 IPDTVLLLILSHLNTQDRAHASMVCRRWNRVCRDATL-WRMLDFSA 116 >SB_43342| Best HMM Match : F-box (HMM E-Value=4.1e-09) Length = 456 Score = 29.9 bits (64), Expect = 4.2 Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 182 VEHLPSEVLLCIFSYLDDLSLCACSCVCTRWWRL 215 + L + V+L IFSYL L + VC RW L Sbjct: 46 ISELDNPVILKIFSYLSRADLLKAAEVCKRWHEL 79 >SB_28812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 29.5 bits (63), Expect = 5.5 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Query: 282 RLRIELKMLRNDPPEGIAATPLDPKCCHWQASVTGPVGSPYEGGVFY 328 RL E K LRN E A PL+ W +V GP + + GG ++ Sbjct: 14 RLMREAKELRN-ATELYHAQPLEDNLFEWHFTVRGPPDTEFAGGRYH 59 >SB_20396| Best HMM Match : SEC-C (HMM E-Value=1.5) Length = 715 Score = 29.5 bits (63), Expect = 5.5 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 267 VQAQPAGEENAWRRNRLRIELKMLRNDP-PEGI 298 +Q P+ E N WR N +IE ++ DP PEG+ Sbjct: 61 LQNLPSPENNGWRINAGQIEPLLMSRDPAPEGL 93 >SB_31644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 935 Score = 29.1 bits (62), Expect = 7.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 193 IFSYLDDLSLCACSCVCTRW 212 +F YLD L LC + VC W Sbjct: 623 VFRYLDPLELCRLATVCREW 642 >SB_18737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 28.7 bits (61), Expect = 9.6 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 267 VQAQPAGEENAWRRNRLRIELKMLRNDP-PEGI 298 +Q P E N WR N ++E ++ DP PEG+ Sbjct: 588 MQNLPLPENNGWRNNAGQLEPLLMPRDPAPEGL 620 >SB_41941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 254 Score = 28.7 bits (61), Expect = 9.6 Identities = 14/27 (51%), Positives = 17/27 (62%) Query: 185 LPSEVLLCIFSYLDDLSLCACSCVCTR 211 L +E+LL IFS LD S+ S CTR Sbjct: 24 LSTEILLFIFSLLDARSIVRASRACTR 50 >SB_25767| Best HMM Match : F-box (HMM E-Value=9.7e-09) Length = 250 Score = 28.7 bits (61), Expect = 9.6 Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 182 VEHLPSEVLLCIFSYLDDLSLCACSCVCTRWWRL 215 +E LP E++ I YLD L+ + V R+W++ Sbjct: 1 MEDLPDEIVTSILDYLDPLAKLRLARVNKRFWQI 34 >SB_12443| Best HMM Match : WD40 (HMM E-Value=1e-24) Length = 515 Score = 28.7 bits (61), Expect = 9.6 Identities = 14/42 (33%), Positives = 19/42 (45%) Query: 173 PPDNLAPGLVEHLPSEVLLCIFSYLDDLSLCACSCVCTRWWR 214 P L G + LP +LL IF +L + VC +W R Sbjct: 16 PIRELNHGFWQDLPDSLLLFIFGFLTPKEVLTAGEVCRKWHR 57 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.323 0.137 0.465 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,598,495 Number of Sequences: 59808 Number of extensions: 682639 Number of successful extensions: 1412 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 1377 Number of HSP's gapped (non-prelim): 34 length of query: 430 length of database: 16,821,457 effective HSP length: 84 effective length of query: 346 effective length of database: 11,797,585 effective search space: 4081964410 effective search space used: 4081964410 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -