BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001949-TA|BGIBMGA001949-PA|IPR001547|Glycoside hydrolase, family 5, IPR011028|Cyclin-like, IPR002720|Retinoblastoma-associated protein, A-box (723 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 30 1.3 SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p... 27 9.1 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 29.9 bits (64), Expect = 1.3 Identities = 23/101 (22%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Query: 514 SDSPLWDQLSKTPVPASADVSVQDSPFRRTNGLQSPVSTIDRFMSPMAEQAKKQLFKDPI 573 SD+PL ++L + +S+D+ + + N Q + ++ M P + F D Sbjct: 1796 SDTPLQNKLYHPGMWSSSDIRIPN------NSSQLSIDSVRSGMRPFSLSKVPHQFDD-- 1847 Query: 574 KPGQSLLGSPERGDLINFYNKVYVQCMQNFALRFSGRHRDE 614 + G++L E+ +N N + C++NF ++ + ++ DE Sbjct: 1848 EEGKALQIFREKLKDLNCKNSMNEMCIENFLMKCTRKYFDE 1888 >SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 27.1 bits (57), Expect = 9.1 Identities = 24/106 (22%), Positives = 46/106 (43%), Gaps = 6/106 (5%) Query: 495 VIKHLNAVEEEVLESLVWTSDS-PLWDQLSKTPVPASADVSVQDSPFRRTNGLQSPVSTI 553 V ++ + L L+ S++ ++ LS+TP P S + +V D+P + P+ I Sbjct: 370 VTNQSHSQSQNSLHPLISQSETHSIFSALSETPTPVSGNGNVADAPPDFSLSQVMPLDLI 429 Query: 554 DRFMSPMA-----EQAKKQLFKDPIKPGQSLLGSPERGDLINFYNK 594 M P A ++ Q+ + + G S L R ++ + K Sbjct: 430 APSMQPSAVSSPMSESHVQISSEMPRTGMSALPMRPRSQNVDKHRK 475 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,343,773 Number of Sequences: 5004 Number of extensions: 145653 Number of successful extensions: 326 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 326 Number of HSP's gapped (non-prelim): 2 length of query: 723 length of database: 2,362,478 effective HSP length: 78 effective length of query: 645 effective length of database: 1,972,166 effective search space: 1272047070 effective search space used: 1272047070 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -