BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001948-TA|BGIBMGA001948-PA|IPR005334|Tctex-1 (127 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 3.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 4.3 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 3.2 Identities = 7/22 (31%), Positives = 16/22 (72%) Query: 51 IPELCMNLADSIRISVKEENYD 72 +PE+CM ++ I+I +++ + D Sbjct: 449 VPEVCMEISMMIKIRLEKNSID 470 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 4.3 Identities = 8/33 (24%), Positives = 21/33 (63%) Query: 70 NYDRYRIIVSVSIGQRRQQSVHVFHSFLWDPER 102 N +R+R +V+ + +++QQ+ + H+ L ++ Sbjct: 1791 NQERHRSLVTATKTRKKQQTEAIRHAMLQQEDK 1823 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.135 0.388 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,986 Number of Sequences: 2123 Number of extensions: 4032 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 127 length of database: 516,269 effective HSP length: 57 effective length of query: 70 effective length of database: 395,258 effective search space: 27668060 effective search space used: 27668060 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -