BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001945-TA|BGIBMGA001945-PA|IPR000437|Prokaryotic membrane lipoprotein lipid attachment site, IPR006761|Twisted gastrulation (Tsg) protein (240 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 26 0.23 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 26 0.23 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 26 0.23 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 4.9 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 26.2 bits (55), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Query: 101 TSD-PDAQQ---RWLSMTY--PVDIDLSAYRPVPEKQVVYHLQSVEQDSEPVNTD 149 TSD P+AQQ + + Y P S P ++V YH Q++ QD+ +NT+ Sbjct: 26 TSDIPNAQQMPPHYSNYHYEDPYGYTGSEETPPSPQEVYYHHQTIPQDNPIINTE 80 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 26.2 bits (55), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Query: 101 TSD-PDAQQ---RWLSMTY--PVDIDLSAYRPVPEKQVVYHLQSVEQDSEPVNTD 149 TSD P+AQQ + + Y P S P ++V YH Q++ QD+ +NT+ Sbjct: 26 TSDIPNAQQMPPHYSNYHYEDPYGYTGSEETPPSPQEVYYHHQTIPQDNPIINTE 80 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 26.2 bits (55), Expect = 0.23 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 6/55 (10%) Query: 101 TSD-PDAQQ---RWLSMTY--PVDIDLSAYRPVPEKQVVYHLQSVEQDSEPVNTD 149 TSD P+AQQ + + Y P S P ++V YH Q++ QD+ +NT+ Sbjct: 26 TSDIPNAQQMPPHYSNYHYEDPYGYTGSEETPPSPQEVYYHHQTIPQDNPIINTE 80 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Query: 70 CPKPNDTQTELSKT 83 CPK T TELSK+ Sbjct: 734 CPKNRPTFTELSKS 747 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,997 Number of Sequences: 317 Number of extensions: 2247 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 240 length of database: 114,650 effective HSP length: 55 effective length of query: 185 effective length of database: 97,215 effective search space: 17984775 effective search space used: 17984775 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -