BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001945-TA|BGIBMGA001945-PA|IPR000437|Prokaryotic membrane lipoprotein lipid attachment site, IPR006761|Twisted gastrulation (Tsg) protein (240 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosa... 26 4.3 SPAP27G11.15 |slx1||structure-specific endonuclease catalytic su... 25 9.8 >SPAC1805.04 |nup132|Nup133b, Nup133b|nucleoporin Nup132|Schizosaccharomyces pombe|chr 1|||Manual Length = 1162 Score = 26.2 bits (55), Expect = 4.3 Identities = 12/47 (25%), Positives = 22/47 (46%) Query: 121 LSAYRPVPEKQVVYHLQSVEQDSEPVNTDMVTFNCTVAYMSQCMSCD 167 +S Y P V + + ++S ++ + N Y+S C+SCD Sbjct: 1114 ISIYPPARFGDVTEVTKVLNRESVKLDHYLTKTNLNTCYISMCLSCD 1160 >SPAP27G11.15 |slx1||structure-specific endonuclease catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 25.0 bits (52), Expect = 9.8 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 3/55 (5%) Query: 155 CTVAYMSQCMSCDKCRASCRSMGANSIRWFHDGCCECVGDKCLYYGINESRCLAC 209 C + Y +C+ D+ RA+C NSI + ++C I E C C Sbjct: 180 CNLCY--ECIESDELRANCPFTDCNSINHLTCLASSFLTEECQVLPI-EGMCTKC 231 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.320 0.134 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,008,812 Number of Sequences: 5004 Number of extensions: 37263 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 76 Number of HSP's gapped (non-prelim): 2 length of query: 240 length of database: 2,362,478 effective HSP length: 71 effective length of query: 169 effective length of database: 2,007,194 effective search space: 339215786 effective search space used: 339215786 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -