BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001945-TA|BGIBMGA001945-PA|IPR000437|Prokaryotic membrane lipoprotein lipid attachment site, IPR006761|Twisted gastrulation (Tsg) protein (240 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 27 0.49 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 4.6 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 27.1 bits (57), Expect = 0.49 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 15/64 (23%) Query: 166 CDKCRASCRSMGA-NSIRWFHDGCCEC----VGDKC-----LYYGINESRCLAC---PGG 212 C+ C +C +G+ N+ + G C C VG KC YYG +E C AC P G Sbjct: 936 CESC--NCDPIGSYNASCDTYSGDCFCKPGVVGKKCDKCAPAYYGFSEDGCHACDCDPSG 993 Query: 213 KETS 216 + S Sbjct: 994 SKGS 997 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 4.6 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 195 KCLYYGINESRCLACPGGKE 214 KC YG +E C C G K+ Sbjct: 645 KCTGYGFHEQFCQECTGYKK 664 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.134 0.428 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 244,938 Number of Sequences: 2123 Number of extensions: 9921 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 12 Number of HSP's gapped (non-prelim): 2 length of query: 240 length of database: 516,269 effective HSP length: 62 effective length of query: 178 effective length of database: 384,643 effective search space: 68466454 effective search space used: 68466454 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -