BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001943-TA|BGIBMGA001943-PA|IPR003348|Anion-transporting ATPase (335 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 23 5.0 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 23 5.0 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.6 bits (46), Expect = 5.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 108 ESEAMRLDKGVMQEIVGAFPGIDEAMSYAEVMKLVK 143 E ++ LD+ V++++V I +A Y KLVK Sbjct: 86 ELTSIYLDENVIKKLVAECSVISDANIYIRFNKLVK 121 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 22.6 bits (46), Expect = 5.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Query: 108 ESEAMRLDKGVMQEIVGAFPGIDEAMSYAEVMKLVK 143 E ++ LD+ V++++V I +A Y KLVK Sbjct: 86 ELTSIYLDENVIKKLVAECSVISDANIYIRFNKLVK 121 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.135 0.386 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,154 Number of Sequences: 429 Number of extensions: 3172 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 2 length of query: 335 length of database: 140,377 effective HSP length: 58 effective length of query: 277 effective length of database: 115,495 effective search space: 31992115 effective search space used: 31992115 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -