BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001942-TA|BGIBMGA001942-PA|IPR002052|N-6 Adenine-specific DNA methylase, IPR001680|WD-40 repeat, IPR011046|WD40-like (763 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 25 2.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 3.4 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 24 4.5 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.6 bits (51), Expect = 2.6 Identities = 14/51 (27%), Positives = 24/51 (47%) Query: 615 DWRVKIWEDGREEPLFMFELGAAVGDVKWAPYSSTVFAACTADGKVYVYDL 665 DW+ K+ GR++ ++L G ++ S FAA D Y++ L Sbjct: 1248 DWKYKVKCVGRKQLAQKYQLPKMGGPQPYSACSENAFAAYPGDCTRYLHCL 1298 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 24.2 bits (50), Expect = 3.4 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 512 RVVQWAVMPGELQATTIITLTSNVPPIPGP 541 R V PG ++ + +++ +N PP P P Sbjct: 707 RAVNIGQQPGAKESISYLSMENNAPPPPPP 736 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 23.8 bits (49), Expect = 4.5 Identities = 17/62 (27%), Positives = 26/62 (41%) Query: 265 ANYGSTALQCIIFDYYQEDYARKQREKEEDKPKRHPIDNLKQLRKKTAKHVKSAQQIHDE 324 A G T L FD DY K +++ K R L++LR++ K + +H Sbjct: 48 ATSGDTHLGGEDFDQKVMDYFIKMVKQKHKKDIRADKKALQKLRREVEKAKRDLSSVHKT 107 Query: 325 QL 326 L Sbjct: 108 TL 109 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.136 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,806 Number of Sequences: 317 Number of extensions: 8388 Number of successful extensions: 40 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 37 Number of HSP's gapped (non-prelim): 3 length of query: 763 length of database: 114,650 effective HSP length: 62 effective length of query: 701 effective length of database: 94,996 effective search space: 66592196 effective search space used: 66592196 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -