BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001941-TA|BGIBMGA001941-PA|undefined (93 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 1.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 1.5 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Query: 40 AGPPQPPDGVACRHQPRESVTSHSRE--RYTRILSPRDQQVSRH 81 +G P+PP H S + S+E + RDQ V+R+ Sbjct: 1854 SGSPEPPPPPPRNHDQNNSSFNDSKESNEISEAECDRDQLVNRN 1897 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.132 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,989 Number of Sequences: 429 Number of extensions: 1294 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of query: 93 length of database: 140,377 effective HSP length: 48 effective length of query: 45 effective length of database: 119,785 effective search space: 5390325 effective search space used: 5390325 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.5 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -