BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001941-TA|BGIBMGA001941-PA|undefined
(93 letters)
Database: bee
429 sequences; 140,377 total letters
Searching.....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 1.5
>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
Length = 1946
Score = 21.8 bits (44), Expect = 1.5
Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%)
Query: 40 AGPPQPPDGVACRHQPRESVTSHSRE--RYTRILSPRDQQVSRH 81
+G P+PP H S + S+E + RDQ V+R+
Sbjct: 1854 SGSPEPPPPPPRNHDQNNSSFNDSKESNEISEAECDRDQLVNRN 1897
Database: bee
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 140,377
Number of sequences in database: 429
Lambda K H
0.321 0.132 0.408
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,989
Number of Sequences: 429
Number of extensions: 1294
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 93
length of database: 140,377
effective HSP length: 48
effective length of query: 45
effective length of database: 119,785
effective search space: 5390325
effective search space used: 5390325
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 38 (20.5 bits)
S2: 38 (19.4 bits)
- SilkBase 1999-2023 -