Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001940-TA|BGIBMGA001940-PA|IPR000504|RNA-binding region
RNP-1 (RNA recognition motif)
         (280 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   5.9  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
           protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 5.9
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 13/70 (18%)

Query: 77  REFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYG--FVRF-GNEDEQ 133
           +EF  W      D+D+ +LY     + TS+K  K IL   G+T   G  + R  G+   +
Sbjct: 684 KEFDPWA-----DLDN-NLYE----RVTSLKDTKAILSLGGWTDSAGDKYSRLVGDGSAR 733

Query: 134 RNALYAMNGY 143
           R  + A+ G+
Sbjct: 734 RRFVVAVVGF 743


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.134    0.416 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,328
Number of Sequences: 317
Number of extensions: 2653
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 280
length of database: 114,650
effective HSP length: 56
effective length of query: 224
effective length of database: 96,898
effective search space: 21705152
effective search space used: 21705152
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)