BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001940-TA|BGIBMGA001940-PA|IPR000504|RNA-binding region
RNP-1 (RNA recognition motif)
(280 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.9
>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10
protein.
Length = 2700
Score = 21.8 bits (44), Expect = 5.9
Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 13/70 (18%)
Query: 77 REFSVWVGDLSPDVDDYSLYRVFASKYTSIKTAKVILDNSGYTKGYG--FVRF-GNEDEQ 133
+EF W D+D+ +LY + TS+K K IL G+T G + R G+ +
Sbjct: 684 KEFDPWA-----DLDN-NLYE----RVTSLKDTKAILSLGGWTDSAGDKYSRLVGDGSAR 733
Query: 134 RNALYAMNGY 143
R + A+ G+
Sbjct: 734 RRFVVAVVGF 743
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.317 0.134 0.416
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 66,328
Number of Sequences: 317
Number of extensions: 2653
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 280
length of database: 114,650
effective HSP length: 56
effective length of query: 224
effective length of database: 96,898
effective search space: 21705152
effective search space used: 21705152
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)
- SilkBase 1999-2023 -