BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001939-TA|BGIBMGA001939-PA|undefined (789 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 29 0.093 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 1.1 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 4.6 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 29.5 bits (63), Expect = 0.093 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 539 KEPSKFHPSNIMESLAEKENDKNISQNPSYDTNRKTLNVTDTNNSKHDTLRMKIEN 594 K P +P+ SL E + K S+ P+ DTN T V D N S ++ +N Sbjct: 57 KNPPNLNPAVQGSSLTEGKRSKR-SKRPNGDTNGDTSQVDDQNESLEASVNENSKN 111 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 1.1 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Query: 95 LEQHPKKDIENANKNFLLDQWIAKIGVP 122 L HP+ ++ N NF ++ WI++ GVP Sbjct: 1606 LYYHPEDEVVFYNANFSINYWISE-GVP 1632 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.8 bits (49), Expect = 4.6 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query: 461 DAIHLEPI-MEELDDLTDMDITNKKRLNSESSLVATI 496 + IHL+ +E L+ M++ + KRLN + + +ATI Sbjct: 119 EQIHLDDNRIESLERRAFMNLKSLKRLNLKGNKIATI 155 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.311 0.127 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,559 Number of Sequences: 317 Number of extensions: 7488 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 4 length of query: 789 length of database: 114,650 effective HSP length: 62 effective length of query: 727 effective length of database: 94,996 effective search space: 69062092 effective search space used: 69062092 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -