BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001939-TA|BGIBMGA001939-PA|undefined (789 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 29 0.63 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 27 1.4 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 27 2.5 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 26 3.3 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 28.7 bits (61), Expect = 0.63 Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 527 SNLDPILSEALWKEPSKFHPSNIME 551 +N D +S ALW EP +F P ++ Sbjct: 125 NNYDLSMSPALWDEPERFRPERFLQ 149 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 27.5 bits (58), Expect = 1.4 Identities = 22/93 (23%), Positives = 36/93 (38%), Gaps = 1/93 (1%) Query: 527 SNLDPILSEALWKEPSKFHPSNIMESLAEKEN-DKNISQNPSYDTNRKTLNVTDTNNSKH 585 +N + SE W EP +F+PS E + E KNI + ++T + Sbjct: 63 NNYELNTSERYWSEPKRFNPSRENERTLQIERVRKNIPHFLPFSIGKRTCIGQNLVRGFS 122 Query: 586 DTLRMKIENNFNNHSTNYTRSKMKNLKTLPDPD 618 + I ++ HS + + KM PD Sbjct: 123 FIIIANILQKYDVHSNDLSLIKMYPACVAVPPD 155 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 26.6 bits (56), Expect = 2.5 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 3/81 (3%) Query: 526 ASNLDPILSEALWKEPSKFHPSNIMESLAEKENDKNISQNPSYDTNRKTLNVT-DTNNSK 584 A L P+L++ +PS+ H S SL N + + T ++ +T D + Sbjct: 141 ADKLTPVLAKPSVSQPSRTHTSTNASSL-NATNTRTTKTASTRRTFTNSMELTADIQQAA 199 Query: 585 HDTLRMKIENNFNNHSTNYTR 605 +DT ++ ++ NH T+ T+ Sbjct: 200 NDTNTVEASDSC-NHYTHRTK 219 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 26.2 bits (55), Expect = 3.3 Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 702 HLNSDEENLCNTSESTSKTLDVMSSKNN 729 HL++DE+ + SE S +D++ +N Sbjct: 342 HLDADEQQIPTLSEMVSTAMDILERNDN 369 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.311 0.127 0.365 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,675 Number of Sequences: 2123 Number of extensions: 29906 Number of successful extensions: 71 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 67 Number of HSP's gapped (non-prelim): 4 length of query: 789 length of database: 516,269 effective HSP length: 69 effective length of query: 720 effective length of database: 369,782 effective search space: 266243040 effective search space used: 266243040 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -