SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001937-TA|BGIBMGA001937-PA|IPR011497|Protease inhibitor,
Kazal-type, IPR003645|Follistatin-like, N-terminal,
IPR002350|Proteinase inhibitor I1, Kazal
         (132 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomy...    25   5.1  

>SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 543

 Score = 24.6 bits (51), Expect = 5.1
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 10  VSALRMTRAECCTGASRSPAAWSPKDYDSGEIFFYKVLSGGVPCNA 55
           + AL    +  C  +SR   A++      G   F K+  GG+P NA
Sbjct: 343 IIALCFNCSALCLASSREIFAFARDKGLPGSWIFRKLTPGGIPLNA 388


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.322    0.131    0.431 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 486,392
Number of Sequences: 5004
Number of extensions: 12764
Number of successful extensions: 11
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 10
Number of HSP's gapped (non-prelim): 1
length of query: 132
length of database: 2,362,478
effective HSP length: 66
effective length of query: 66
effective length of database: 2,032,214
effective search space: 134126124
effective search space used: 134126124
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 49 (23.8 bits)

- SilkBase 1999-2023 -