BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001934-TA|BGIBMGA001934-PA|IPR008465|Dystroglycan (318 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 6.8 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 9.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 6.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Query: 288 LTRVKVKIKPKNVSRTCSKSPSTTV 312 +T +K KPK + + SPS TV Sbjct: 1544 VTELKQAFKPKGYLLSAAVSPSKTV 1568 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/39 (23%), Positives = 20/39 (51%) Query: 174 KIVPRQRIRALMQLANFMALDGDEFWMEPYKTETHPDTI 212 +I +Q + AL+ + ++ +E W + +T P T+ Sbjct: 93 QISQQQSVTALLDTGSEVSCISEEVWSKLIETGNKPPTL 131 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,426 Number of Sequences: 317 Number of extensions: 2578 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 318 length of database: 114,650 effective HSP length: 57 effective length of query: 261 effective length of database: 96,581 effective search space: 25207641 effective search space used: 25207641 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -