BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001934-TA|BGIBMGA001934-PA|IPR008465|Dystroglycan (318 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18750.1 68415.m02183 calmodulin-binding protein similar to c... 28 7.2 >At2g18750.1 68415.m02183 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 622 Score = 28.3 bits (60), Expect = 7.2 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Query: 134 TDSFTIEVKKGE-DKPHSKYGTCIGDENRLVLLILVDGAFHKIVPRQRIRALMQLANFMA 192 T++FT++ +GE K H Y + DE + I DGAFHK + + I + + M Sbjct: 237 TEAFTVKDHRGELYKKH--YPPALDDEVWRLEKIGKDGAFHKKLNKAGIYNVKEFLRLMV 294 Query: 193 LDGDE 197 D + Sbjct: 295 KDSQK 299 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.321 0.137 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,121,611 Number of Sequences: 28952 Number of extensions: 276376 Number of successful extensions: 529 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 529 Number of HSP's gapped (non-prelim): 1 length of query: 318 length of database: 12,070,560 effective HSP length: 81 effective length of query: 237 effective length of database: 9,725,448 effective search space: 2304931176 effective search space used: 2304931176 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -