Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001934-TA|BGIBMGA001934-PA|IPR008465|Dystroglycan
         (318 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g18750.1 68415.m02183 calmodulin-binding protein similar to c...    28   7.2  

>At2g18750.1 68415.m02183 calmodulin-binding protein similar to
           calmodulin-binding protein TCB60 GI:1698548 from
           [Nicotiana tabacum]
          Length = 622

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 134 TDSFTIEVKKGE-DKPHSKYGTCIGDENRLVLLILVDGAFHKIVPRQRIRALMQLANFMA 192
           T++FT++  +GE  K H  Y   + DE   +  I  DGAFHK + +  I  + +    M 
Sbjct: 237 TEAFTVKDHRGELYKKH--YPPALDDEVWRLEKIGKDGAFHKKLNKAGIYNVKEFLRLMV 294

Query: 193 LDGDE 197
            D  +
Sbjct: 295 KDSQK 299


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.321    0.137    0.418 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,121,611
Number of Sequences: 28952
Number of extensions: 276376
Number of successful extensions: 529
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 529
Number of HSP's gapped (non-prelim): 1
length of query: 318
length of database: 12,070,560
effective HSP length: 81
effective length of query: 237
effective length of database: 9,725,448
effective search space: 2304931176
effective search space used: 2304931176
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 59 (27.9 bits)