GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001934-TA|BGIBMGA001934-PA|IPR008465|Dystroglycan
         (318 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L14433-6|AAA27974.2| 2107|Caenorhabditis elegans Hypothetical pr...    31   1.1  

>L14433-6|AAA27974.2| 2107|Caenorhabditis elegans Hypothetical protein
            C50C3.2 protein.
          Length = 2107

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 4/74 (5%)

Query: 190  FMALDGDEFWMEPYKTETHPDTILSGIGSSLRKRGDATTAIYLNVGCGNKLWDRHKVLVA 249
            F  LDG   W+   +T+ H  T   G+ +S+    DA  A  L V  G +  ++  +L+ 
Sbjct: 1339 FELLDGMSIWLIDAETDVHSTTNFIGLYNSV----DAEKASRLLVSLGEQAGEKDDILIR 1394

Query: 250  GLREQSRDGTLEQL 263
               ++S D  +E+L
Sbjct: 1395 IQCDESVDVIVEKL 1408


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.321    0.137    0.418 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,287,508
Number of Sequences: 27539
Number of extensions: 278770
Number of successful extensions: 460
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 460
Number of HSP's gapped (non-prelim): 1
length of query: 318
length of database: 12,573,161
effective HSP length: 81
effective length of query: 237
effective length of database: 10,342,502
effective search space: 2451172974
effective search space used: 2451172974
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 60 (28.3 bits)