BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001932-TA|BGIBMGA001932-PA|undefined (74 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 23 1.1 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 1.1 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 22 2.5 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 23.0 bits (47), Expect = 1.1 Identities = 12/43 (27%), Positives = 17/43 (39%) Query: 29 CHTAIAKRHWLSFARGPISRYILNQKATEYEAIWLVVREGNKE 71 CH +W S+ S + A + IWL RE +E Sbjct: 282 CHWGFNSSNWRSYIHVAESEKNREEHAQVLDKIWLKEREIEQE 324 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.0 bits (47), Expect = 1.1 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Query: 13 YIILIVWIADQYDAI--CCHTAIAKRHWLSFARGPISRYILNQKATE 57 Y+I + D++ I CCH ++A W S Y + +TE Sbjct: 133 YLISVNRRVDRFSKIYCCCHFSMATFFWFMPVWTTYSAYFAVRNSTE 179 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 21.8 bits (44), Expect = 2.5 Identities = 11/41 (26%), Positives = 18/41 (43%), Gaps = 6/41 (14%) Query: 8 TTTAFYIILIVWIADQYDAICCHTAIAKRHWLSFARGPISR 48 +T AF++ L W A Q T+ W++ P+ R Sbjct: 416 STAAFFLFLARWFAQQI------TSSTDARWVAIQGNPVVR 450 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.327 0.137 0.448 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,808 Number of Sequences: 2123 Number of extensions: 2192 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 74 length of database: 516,269 effective HSP length: 51 effective length of query: 23 effective length of database: 407,996 effective search space: 9383908 effective search space used: 9383908 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -