BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001931-TA|BGIBMGA001931-PA|undefined (412 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 25 1.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 9.2 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 24.6 bits (51), Expect = 1.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Query: 234 IWEGILGLVEDIDKDSKLIDESLDESAANESSKDD 268 +W GIL + D K +D+ L ++ E+S DD Sbjct: 161 LWVGILSTIFLCDTILKKVDDILSQAYKLEASFDD 195 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.8 bits (44), Expect = 9.2 Identities = 7/17 (41%), Positives = 11/17 (64%) Query: 9 ANNLPPGVNPENNFLPG 25 +N+L G NP++ PG Sbjct: 3 SNSLTAGCNPDSELFPG 19 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.138 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,159 Number of Sequences: 317 Number of extensions: 3382 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 412 length of database: 114,650 effective HSP length: 58 effective length of query: 354 effective length of database: 96,264 effective search space: 34077456 effective search space used: 34077456 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -