BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001930-TA|BGIBMGA001930-PA|undefined (238 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 1.9 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 22 5.7 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.4 bits (48), Expect = 1.9 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 5/50 (10%) Query: 140 FRGRKCSKKCINSIEILRKQEKAAALTVCQCDGTEDYDCPTMQENLARLC 189 F +K KK ++ ++ILR + + +CD C T Q N +C Sbjct: 120 FEEQKRRKKSLDDVKILRNDRIDSYKSNLKCD-----KCSTYQSNGEEVC 164 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/25 (36%), Positives = 14/25 (56%), Gaps = 2/25 (8%) Query: 129 LQYY--HHLCRSMFRGRKCSKKCIN 151 L+Y+ +H F+ KCS C+N Sbjct: 4 LEYHLRNHFGSKPFKCEKCSYSCVN 28 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.323 0.131 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,054 Number of Sequences: 429 Number of extensions: 2421 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 2 length of query: 238 length of database: 140,377 effective HSP length: 56 effective length of query: 182 effective length of database: 116,353 effective search space: 21176246 effective search space used: 21176246 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -