BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001929-TA|BGIBMGA001929-PA|IPR002198|Short-chain dehydrogenase/reductase SDR, IPR002347|Glucose/ribitol dehydrogenase, IPR002539|MaoC-like dehydratase, IPR003033|Sterol-binding (722 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding pr... 27 2.3 AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 25 9.3 >AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding protein AgamOBP25 protein. Length = 149 Score = 26.6 bits (56), Expect = 2.3 Identities = 9/33 (27%), Positives = 19/33 (57%) Query: 360 ILAGMCMEAPIVANAMPPGKFADFTNVLHGEQY 392 +L+ +C++A + A PP D + + +GE + Sbjct: 9 VLSAICLDALVDGAAAPPPDLEDVSKIANGEAF 41 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 24.6 bits (51), Expect = 9.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Query: 641 ITDNGKTVKQWTLDL 655 + DNGKT K W L L Sbjct: 32 LKDNGKTCKSWPLQL 46 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.133 0.383 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,511 Number of Sequences: 2123 Number of extensions: 27094 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 41 Number of HSP's gapped (non-prelim): 2 length of query: 722 length of database: 516,269 effective HSP length: 69 effective length of query: 653 effective length of database: 369,782 effective search space: 241467646 effective search space used: 241467646 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -