BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001927-TA|BGIBMGA001927-PA|IPR000092|Polyprenyl synthetase, IPR008949|Terpenoid synthase (592 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 28 0.61 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 26 2.4 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 28.3 bits (60), Expect = 0.61 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 5/73 (6%) Query: 398 IFNEALLYTSMGQHLDYAMAHRNKQDYSLFTTERYYSIVKYKTSYYSIKLPVVLGLILTQ 457 + N AL T G+H + ++H N+ D T I++ ++S IK + G + Sbjct: 275 LLNSALNRTYPGRHANMVLSHVNRPDDDAVAT-----ILELESSLGRIKEAIQSGFAMAA 329 Query: 458 NRENAPIEDIEGI 470 + P++ +GI Sbjct: 330 DGTRVPLDPKKGI 342 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 26.2 bits (55), Expect = 2.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Query: 535 DDVASIKRLYEDLQLPKLYKEQEDE 559 D V ++RL+E+L + KL EQ+ E Sbjct: 87 DSVTVLRRLFEELNIKKLCYEQDCE 111 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.320 0.136 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,642 Number of Sequences: 2123 Number of extensions: 22766 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 43 Number of HSP's gapped (non-prelim): 2 length of query: 592 length of database: 516,269 effective HSP length: 68 effective length of query: 524 effective length of database: 371,905 effective search space: 194878220 effective search space used: 194878220 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -