BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001927-TA|BGIBMGA001927-PA|IPR000092|Polyprenyl synthetase, IPR008949|Terpenoid synthase (592 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 26 0.64 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 23 5.9 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 5.9 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 5.9 EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 pr... 23 7.8 DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory pro... 23 7.8 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 26.2 bits (55), Expect = 0.64 Identities = 27/115 (23%), Positives = 46/115 (40%), Gaps = 10/115 (8%) Query: 97 LLLAENVDEKIYKSAQDICLEIGTMFQIQ--DDFIDCFGDEIKTGKVGTDIQERKCTWLA 154 +LLA + + ++ Q I ++ +FQ Q D+ + GD + ++QE K A Sbjct: 10 MLLANHKNVQVGDLVQKIAQKLQVLFQDQIVDEMVTVLGD-LHRKPTYNNLQEMKYLERA 68 Query: 155 VQALQRCTEAQRTV-------FKACYGSSEPAHVERIKRLYEDLHLPQIYKHQEK 202 ++ R + + F C G P +Y+ H P IY EK Sbjct: 69 IKESLRLYPSVHFISRKLGEDFVTCNGLKLPKSTITHLHIYDLHHNPDIYPDPEK 123 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 532 KDPDDVASIKRLYEDLQLPKLYKEQ 556 +DP+DV + Y DL L + K + Sbjct: 212 EDPEDVPGCEDYYGDLDLKSIRKSE 236 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.0 bits (47), Expect = 5.9 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 440 TSYYSIKLPVVLGLILTQNRENAPIEDIEGICFEI 474 +SY S K +L L+L E A I+D EGI E+ Sbjct: 259 SSYSSRKRLAMLDLLLKYKSEGANIDD-EGIREEV 292 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.0 bits (47), Expect = 5.9 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Query: 440 TSYYSIKLPVVLGLILTQNRENAPIEDIEGICFEI 474 +SY S K +L L+L E A I+D EGI E+ Sbjct: 259 SSYSSRKRLAMLDLLLKYKSEGANIDD-EGIREEV 292 >EF125546-1|ABL73930.1| 237|Tribolium castaneum obstractor C2 protein. Length = 237 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Query: 532 KDPDDVASIKRLYEDLQLPKLYK 554 +DP+DV + Y+D+ L L K Sbjct: 212 EDPEDVPGCEDYYKDVDLKALKK 234 >DQ855506-1|ABH88193.1| 124|Tribolium castaneum chemosensory protein 20 protein. Length = 124 Score = 22.6 bits (46), Expect = 7.8 Identities = 9/38 (23%), Positives = 20/38 (52%) Query: 100 AENVDEKIYKSAQDICLEIGTMFQIQDDFIDCFGDEIK 137 A+ V + +YK+ QD ++ + + ++ DE+K Sbjct: 85 AKTVIQHLYKNKQDWWKQLEAKYDPEHTYVKAHEDELK 122 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.136 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,933 Number of Sequences: 317 Number of extensions: 5552 Number of successful extensions: 16 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 6 length of query: 592 length of database: 114,650 effective HSP length: 61 effective length of query: 531 effective length of database: 95,313 effective search space: 50611203 effective search space used: 50611203 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -