BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001925-TA|BGIBMGA001925-PA|IPR010405|Cofactor of BRCA1 (587 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 23 4.4 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 5.9 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 23.4 bits (48), Expect = 4.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Query: 534 ALQPGTQHNESVHKLYETLQQKLNAQTEP 562 A PG H+E++ E L K N+ T P Sbjct: 15 ARSPGGDHSENMQDEPENLSNKSNSITVP 43 Score = 22.6 bits (46), Expect = 7.8 Identities = 10/40 (25%), Positives = 16/40 (40%) Query: 404 ESAITTIEHSGPPPDACEAYMRESSVCGVIAMYYTLHAAK 443 + + IEH P+ C R S + M+Y H + Sbjct: 121 QQLVDNIEHKLSDPNQCVICHRVLSCKSALQMHYRTHTGE 160 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/46 (19%), Positives = 22/46 (47%) Query: 523 LPETRIQTLMKALQPGTQHNESVHKLYETLQQKLNAQTEPGPSATE 568 LPE+R+Q K + + + H +++++ + + P T+ Sbjct: 108 LPESRVQVWFKNRRAKCRQQQKQHNQQQSVEKSSKLKNKSAPILTK 153 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,724 Number of Sequences: 317 Number of extensions: 4639 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 3 length of query: 587 length of database: 114,650 effective HSP length: 61 effective length of query: 526 effective length of database: 95,313 effective search space: 50134638 effective search space used: 50134638 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -