BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001923-TA|BGIBMGA001923-PA|IPR013098|Immunoglobulin I-set, IPR013151|Immunoglobulin, IPR003599|Immunoglobulin subtype, IPR003598|Immunoglobulin subtype 2, IPR007110|Immunoglobulin-like (366 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0180 - 16031366-16031445,16031950-16032022,16032148-160321... 31 1.5 12_01_1105 + 11672118-11673245 29 4.5 12_02_0412 - 18799217-18801061 29 5.9 05_04_0278 - 19694590-19694757,19696331-19696391,19696503-196966... 29 7.8 >02_03_0180 - 16031366-16031445,16031950-16032022,16032148-16032186, 16032434-16032715,16032790-16032948,16033034-16033390, 16033482-16033622,16033919-16034045,16034121-16034263, 16034740-16034917,16035019-16035552,16035628-16035812, 16036551-16036637,16036710-16036850,16036896-16037175, 16037944-16038020,16038326-16039138,16039292-16039801, 16039926-16040056,16040192-16040246,16040364-16040564, 16040640-16040909,16041103-16041184,16041271-16041434, 16041532-16041690,16041762-16042083,16042158-16042544, 16042811-16042999,16043233-16043317,16043458-16043753, 16043862-16043965,16044484-16044513,16044602-16044817, 16044923-16045540,16045718-16045993,16046619-16046762, 16046854-16046962,16047291-16047475,16047557-16047670, 16048348-16048479,16048929-16049249,16049424-16049891, 16054482-16054547,16054691-16054828,16054917-16055015, 16057098-16057194,16057661-16057761,16057858-16058085, 16059175-16059381,16059451-16059571,16059921-16059988, 16060148-16060213,16060396-16060509,16060949-16061300, 16063571-16063663,16063764-16063922,16064224-16064287, 16064385-16064577,16064673-16064710,16065510-16065645, 16065726-16065914,16065994-16066095,16067660-16067777, 16067861-16067964,16070338-16070346,16071428-16071475, 16071581-16071676,16072430-16072533,16073964-16074045, 16076573-16076601,16076708-16076963 Length = 4246 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 72 WEVHVPDEYVIAGNAVVLRCVVPPHCADRISST 104 W P YVI G+ V RCV P +S+T Sbjct: 2174 WRPQAPSNYVILGDCVSSRCVPPSQVVVAVSNT 2206 >12_01_1105 + 11672118-11673245 Length = 375 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Query: 307 WLHNGRTLEPNERIEILEDGLRLHIKNTHKDDQGI-YQCFASNARDQA 353 W+ +P ERI ++ + +H K D GI Y C +N D A Sbjct: 299 WVETQEEEDPEERIFETQEHITVHPKTCEDHDDGIPYSCPTTNTMDIA 346 >12_02_0412 - 18799217-18801061 Length = 614 Score = 29.1 bits (62), Expect = 5.9 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 4/91 (4%) Query: 208 YRWFFEHHEQLTPIEETTLWKRARLLDEGLLSIQKVRREDAGRFVCWLNNTVGSESVHFT 267 +RW E + E+ TLW+ A L++ Q ++ +AG V V + F Sbjct: 122 WRWIAERFIPVLKQEQVTLWETAESYFNELVNRQLIQPVEAGDVV---KVKVHDVVLEFI 178 Query: 268 LIVTEPISVRTKPEVLRSKPKSDIALDCKVN 298 V + T VLR KP+ DI +N Sbjct: 179 ASVAAEENFVTSDMVLRCKPR-DIVRRASLN 208 >05_04_0278 - 19694590-19694757,19696331-19696391,19696503-19696658, 19696740-19696912,19698199-19698276,19698399-19698575, 19698924-19699001,19700573-19700692,19700803-19701183 Length = 463 Score = 28.7 bits (61), Expect = 7.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Query: 334 THKDDQGIYQCFASNARDQAYGM 356 TH D +G +CF SN +DQA M Sbjct: 302 THIDSRGDGRCFISNGKDQAIKM 324 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.136 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,275,881 Number of Sequences: 37544 Number of extensions: 478527 Number of successful extensions: 912 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 910 Number of HSP's gapped (non-prelim): 4 length of query: 366 length of database: 14,793,348 effective HSP length: 83 effective length of query: 283 effective length of database: 11,677,196 effective search space: 3304646468 effective search space used: 3304646468 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -