BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001922-TA|BGIBMGA001922-PA|undefined (57 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2C4.11c |rbp28||RNA-binding protein Rbp28|Schizosaccharomyce... 25 0.91 SPCC4G3.03 |||WD repeat protein|Schizosaccharomyces pombe|chr 3|... 23 3.7 SPBC713.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 23 6.4 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 22 8.4 SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces... 22 8.4 >SPAC2C4.11c |rbp28||RNA-binding protein Rbp28|Schizosaccharomyces pombe|chr 1|||Manual Length = 258 Score = 25.4 bits (53), Expect = 0.91 Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 6 KHNLGVEFASRTKFQLAQNKAAKSEGFMNLTIRR 39 K +E ASRT+ LA +K GF N+ I + Sbjct: 195 KTKFAIENASRTRIVLADSKIHILGGFTNIRIAK 228 >SPCC4G3.03 |||WD repeat protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 347 Score = 23.4 bits (48), Expect = 3.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 1 MTVCDKHNLGVEFASR 16 M +CD+HN G+E R Sbjct: 109 MKLCDQHNNGIEIHRR 124 >SPBC713.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 395 Score = 22.6 bits (46), Expect = 6.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Query: 12 EFASRTKFQLAQNKAAKSEG 31 EF R K + QNK SEG Sbjct: 274 EFEEREKSAIKQNKEQSSEG 293 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 22.2 bits (45), Expect = 8.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Query: 18 KFQLAQNKAAKSEGFMNLTIRRTLK 42 KFQL + E F N+T+R T K Sbjct: 946 KFQLLSVDPSTLERFRNVTLRLTKK 970 >SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 326 Score = 22.2 bits (45), Expect = 8.4 Identities = 8/23 (34%), Positives = 16/23 (69%) Query: 12 EFASRTKFQLAQNKAAKSEGFMN 34 E++S +KF+ N+++ + GF N Sbjct: 30 EYSSTSKFETLGNQSSTNLGFSN 52 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.315 0.124 0.333 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,234 Number of Sequences: 5004 Number of extensions: 4575 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 5 length of query: 57 length of database: 2,362,478 effective HSP length: 38 effective length of query: 19 effective length of database: 2,172,326 effective search space: 41274194 effective search space used: 41274194 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -