GeneModel BLAST Result against mosquito

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001922-TA|BGIBMGA001922-PA|undefined
         (57 letters)

Database: mosquito 
           2123 sequences; 516,269 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-18|CAD27769.1|  257|Anopheles gambiae hypothetical prot...    21   5.8  

>AJ439060-18|CAD27769.1|  257|Anopheles gambiae hypothetical protein
           protein.
          Length = 257

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 10/39 (25%), Positives = 18/39 (46%)

Query: 16  RTKFQLAQNKAAKSEGFMNLTIRRTLKQSPTSIKTEEAQ 54
           R + +L    A +++ F N  IR     SP +  +  A+
Sbjct: 141 RKRLRLKHTFAQEAKQFCNAEIRAAKADSPENCHSNRAE 179


  Database: mosquito
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 516,269
  Number of sequences in database:  2123
  
Lambda     K      H
   0.315    0.124    0.333 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 42,178
Number of Sequences: 2123
Number of extensions: 1021
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 57
length of database: 516,269
effective HSP length: 36
effective length of query: 21
effective length of database: 439,841
effective search space:  9236661
effective search space used:  9236661
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
S2: 40 (20.2 bits)