BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001922-TA|BGIBMGA001922-PA|undefined
(57 letters)
Database: mosquito
2123 sequences; 516,269 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 21 5.8
>AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein
protein.
Length = 257
Score = 20.6 bits (41), Expect = 5.8
Identities = 10/39 (25%), Positives = 18/39 (46%)
Query: 16 RTKFQLAQNKAAKSEGFMNLTIRRTLKQSPTSIKTEEAQ 54
R + +L A +++ F N IR SP + + A+
Sbjct: 141 RKRLRLKHTFAQEAKQFCNAEIRAAKADSPENCHSNRAE 179
Database: mosquito
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 516,269
Number of sequences in database: 2123
Lambda K H
0.315 0.124 0.333
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 42,178
Number of Sequences: 2123
Number of extensions: 1021
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 57
length of database: 516,269
effective HSP length: 36
effective length of query: 21
effective length of database: 439,841
effective search space: 9236661
effective search space used: 9236661
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
S2: 40 (20.2 bits)
- SilkBase 1999-2023 -