BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001919-TA|BGIBMGA001919-PA|undefined (468 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 24 2.6 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 23 3.5 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 6.1 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.8 bits (49), Expect = 2.6 Identities = 20/78 (25%), Positives = 30/78 (38%) Query: 270 KQDFLKSLKAILCDYLPMETIPKMDNVLIHKRSPYHKLNGIIIVFNDKYTLEEVRFDVTA 329 K+ L+S A+ P++ LIH Y + + KYT E D T Sbjct: 246 KKQHLESPSALQAKVDPLKIPEAEKRKLIHLLQEYRCIFSLRPGLTHKYTHEIKLHDKTP 305 Query: 330 YSRTPSQVLALIRYIYDA 347 + + P V +R DA Sbjct: 306 FLKRPYPVPFALRPAVDA 323 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 114 EIDDTKCTGRIQLKVYYKDDAIPLIFDD 141 ++D T CT + V +DD + + DD Sbjct: 44 DVDPTLCTHLLYAFVGLRDDGVVSVLDD 71 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 6.1 Identities = 8/26 (30%), Positives = 14/26 (53%) Query: 325 FDVTAYSRTPSQVLALIRYIYDAVPF 350 F T + S V + +++YDA+ F Sbjct: 601 FGSTPFKELTSNVFRMNQFVYDAIDF 626 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,142 Number of Sequences: 317 Number of extensions: 4244 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 3 length of query: 468 length of database: 114,650 effective HSP length: 59 effective length of query: 409 effective length of database: 95,947 effective search space: 39242323 effective search space used: 39242323 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -